Freecharge.in Website Analysis Summary

Freecharge.in  |  Easy & FREE Recharge service for prepaid mobile, DTH and data card. Instant Recharge for all Mobile and DTH operators using credit card, debit card, net banking and cash card. Get FREE COUPONS & offers of equal and higher value.
Low trust score  | 
Online Recharge on FreeCharge | Fast & Easy Recharge for Prepaid Mobile, Postpaid Mobile, Datacard & DTH.


Rank
11,240
Rating
E
Trust Score
Low Trust Score
Estimated worth
$1,352,880
Estimated daily income
$1,879
Estimated monthly income
$57,153
Backlinks
0

Freecharge.in has a Low Trust Score, and a Statvoo Rank of E.

Freecharge.in is hosted by Amazon.com Tech Telecom in Singapore, Singapore, Singapore, 179431.
Freecharge.in has an IP Address of 54.169.116.52 and a hostname of ec2-54-169-116-52.ap-southeast-1.compute.amaz.

The domain freecharge.in was registered 1 decade 4 months 2 days ago by , it was last modified 4 years 8 months 1 week ago and currently is set to expire 2 years 4 months 6 days ago.

It is the world's 11,240 most popular site among over 300 million websites.

Freecharge.in has a total of 0 backlinks.

Freecharge.in gets approximately 156,584 unique visitors a day and 939,504 pageviews per day.

Freecharge.in has an estimated worth of $1,352,880.
An average daily income of approximately $1,879, which is wroughly $57,153 per month.

Whois information for freecharge.in

Full Whois Lookup for Freecharge.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D3826110-AFIN
Domain Name:FREECHARGE.IN
Created On:10-Oct-2009 15:31:02 UTC
Last Updated On:06-Jun-2015 06:07:38 UTC
Expiration Date:10-Oct-2017 15:31:02 UTC
Sponsoring Registrar:Net4India (R7-AFIN)
Status:OK
Reason:
Registrant ID:N8R447728
Registrant Name:Accelyst Solutions
Registrant Organization:Accelyst Solutions Private Limited
Registrant Street1:2A, VAIBHAV CHAMBERS, BANDRA KURLA COMPLEX
Registrant Street2:
Registrant Street3:
Registrant City:Mumbai
Registrant State/Province:MH
Registrant Postal Code:400051
Registrant Country:IN
Registrant Phone:+91.111111111
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:N8A36615921
Admin Name:Accelyst Solutions
Admin Organization:Accelyst Solutions Private Limited
Admin Street1:2A, VAIBHAV CHAMBERS, BANDRA KURLA COMPLEX
Admin Street2:
Admin Street3:
Admin City:Mumbai
Admin State/Province:MH
Admin Postal Code:400051
Admin Country:IN
Admin Phone:+91.111111111
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:N8T36615921
Tech Name:Accelyst Solutions
Tech Organization:Accelyst Solutions Private Limited
Tech Street1:2A, VAIBHAV CHAMBERS, BANDRA KURLA COMPLEX
Tech Street2:
Tech Street3:
Tech City:Mumbai
Tech State/Province:MH
Tech Postal Code:400051
Tech Country:IN
Tech Phone:+91.111111111
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:NS-175.AWSDNS-21.COM
Name Server:NS-1592.AWSDNS-07.CO.UK
Name Server:NS-882.AWSDNS-46.NET
Name Server:NS-1418.AWSDNS-49.ORG
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Freecharge.in?

Freecharge.in Web Server Information

Hosted IP Address:54.169.116.52
Hosted Hostname:ec2-54-169-116-52.ap-southeast-1.compute.amaz
Service Provider:Amazon.com Tech Telecom
Hosted Country:SingaporeSG
Location Latitude:1.28967
Location Longitude:103.85
Webserver Software:Not Applicable

HTTP Header Analysis for Freecharge.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Encoding: gzip
Content-Language: en-US
Content-Type: text/html;charset=UTF-8
Date: Mon, 08 Jun 2015 19:51:55 GMT
Server: nginx
Vary: User-Agent
X-Content-Type-Options: nosniff
X-Frame-Options: https://dev.visualwebsiteoptimizer.com
X-XSS-Protection: 1; mode=block
Content-Length: 3513
Connection: keep-alive

Need to find out who hosts Freecharge.in?

Freecharge.in Free SEO Report

Website Inpage Analysis for Freecharge.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:1
Total Images:1
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Freecharge.in

useragentcallbackvarspagenameparamsreferrerfunction

Longtail Keyword Density for Freecharge.in

KeywordsOccurences
var11
function5
spagename3
params3
useragent3
callback3
referrer3

What are the nameservers for freecharge.in?

Freecharge.in Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown