Free Dom – L'actualité de la Réunion en direct

Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: 252,351
Estimated Worth: $2,160
Last updated:2020-10-19

L'actualité de la Réunion en direct


Domain summary

Domain label
freedom
Domain extension
fr
Domain registered:
1998-11-16
Domain updated:
2020-04-02
Global Traffic Rank
252,351
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$2,160
Estimated daily income
$9
Estimated monthly income
$274

Rank summary

How is freedom.fr ranked relative to other sites:

Percentage of visits to freedom.fr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Freedom.fr registered?
A: Freedom.fr was registered 22 years, 3 months, 1 week, 4 days, 21 hours, 14 minutes, 58 seconds ago on Monday, November 16, 1998.
Q: When was the WHOIS for Freedom.fr last updated?
A: The WHOIS entry was last updated 10 months, 3 weeks, 4 days, 21 hours, 14 minutes, 58 seconds ago on Thursday, April 2, 2020.
Q: What are Freedom.fr's nameservers?
A: DNS for Freedom.fr is provided by the following nameservers:
  • joel.ns.cloudflare.com
  • meera.ns.cloudflare.com
Q: Who is the registrar for the Freedom.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for Freedom.fr?
A: Freedom.fr ranks 252,351 globally on Alexa. Freedom.fr has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Freedom.fr each day?
A: Freedom.fr receives approximately 1,497 visitors and 2,994 page impressions per day.
Q: What IP address does Freedom.fr resolve to?
A: Freedom.fr resolves to the IPv4 address 104.24.102.163.
Q: In what country are Freedom.fr servers located in?
A: Freedom.fr has servers located in the United States.
Q: What webserver software does Freedom.fr use?
A: Freedom.fr is powered by CloudFlare webserver.
Q: Who hosts Freedom.fr?
A: Freedom.fr is hosted by CloudFlare, Inc. in United States.
Q: How much is Freedom.fr worth?
A: Freedom.fr has an estimated worth of $2,160. An average daily income of approximately $9, which is roughly $274 per month.

Freedom.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Freedom.fr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Freedom.fr

H1 Headings

0 :

H2 Headings

96 :
  1. Covid-19 : depuis samedi, l’état d’urgence sanitaire de nouveau effectif sur l’île
  2. Professeur décapité : un hommage demain mardi à 18H à Champ Fleuri
  3. Atteinte du coronavirus à 74 ans, elle se sent abandonnée
  4. Le 51ème Tour Auto – Rallye de la Réunion annulé ?
  5. Air Caraïbes soutient l’opération Octobre Rose 2020
  6. Le Gouffre : le PGHM recherche Patrick, disparu depuis vendredi
  7. Collectif CAP 2024: « Ensemble contre le grand bond en arrière !
  8. Covid-19 : Bruno Le Maire annonce 20 milliards d’euros pour renforcer les fonds propres des entreprises
  9. “Game of Thrones”, “Un gars, une fille”… Quelles sont les séries préférées des Français ?
  10. Découvrez le RSA “recentralisé” : l’enjeu, que les chômeurs retrouvent vite un emploi
  11. Epuisé par la rando, un marmaille de 10 ans hélitreuillé à Mafate
  12. Maurice : une ado agressée au couteau par son compagnon
  13. Un enfant de 6 ans a failli se noyer dans la piscine d’un hôtel de l’Ouest
  14. Professeur tué : Gérald Darmanin annonce des opérations de police en cours
  15. Des jeunes ont bloqué l’accès aux locaux de la CINOR
  16. Le Baby Rugby débarque à la Réunion (VIDEO)
  17. Maximin, l’homme aux chiens, fête son anniversaire
  18. Abdoul fait du parapente avec les marmailles de 1000 Sourires (REPORTAGE VIDEO)
  19. Régal a li, le vendredi : découvrez la recette des Pancakes de la Plaine
  20. Lancement de la Concertation Citoyenne sur la TRANSITION ECOLOGIQUE ET SOLIDAIRE
  21. La Mairie de Bras-Panon recrute des services civiques
  22. Distribution en eau interrompue sur Cilaos – Bras Sec
  23. St-Leu : Huguette Bello visite la médiathèque Baguett’
  24. St-Leu : Huguette Bello visite la médiathèque Baguett’
  25. Le Tampon : 200 thermomètres digitaux mis à disposition
  26. André Thien-Ah-Koon accueille l’équipage du Dash-8 à l’aéroport de Pierrefonds
  27. La 2ème édition du Colloque des Services à la personne se tient mercredi 14 octobre
  28. La 1ere “pierre” du CUBE aura lieu mercredi 28 octobre
  29. Témoignage : “on a volé du scorie sur la tombe d’un de mes proches”
  30. La Montagne : Merry et André fêtent leur 50 ans de mariage
  31. Covid-19 : un organisateur d’événements témoigne sur notre antenne
  32. Un ficus de 50 ans “massacré” à St Leu : reportage audio de Charles Luylier
  33. REPLAY/Jérôme Payet, Florian, Mishko M’ba et Philippe Zora
  34. REPLAY/Thierry Jardinot, Mickaël Pouvin, Soan et Nono dans nos studios (REPLAY)
  35. REPLAY/Nathalie et Pascal Legrand du groupe Afatia
  36. REPLAY/Régis Lacaille
  37. Université de la Réunion : encore plus d’étudiants internationaux cette année malgré le contexte saniraire
  38. Le service civique fête ses 10 ans : une journée spéciale le samedi 17 octobre
  39. La 2ème édition “BD & Manga Péi en folie” bat son plein à la FNAC
  40. Le Campus digital Crealise a fait sa rentrée !
  41. “Soit Bien” d’Andy, un clip qui fait le buzz sur les réseaux sociaux
  42. Dj Missiz’H rejoint Kartel Prod !
  43. Semaine de prévention contre les addictions : le spot de Kartel Prod tourné au CHU
  44. L’artiste MAIKO rejoint Kartel Prod
  45. Trump rétrograde Macron au rang de “Premier ministre” lors d’un meeting
  46. Toulouse : 2 hommes condamnés pour avoir prostitué leurs compagnes enceintes
  47. Inde : déclaré mort et placé dans un caisson réfrigérant, il est découvert en vie le lendemain
  48. 60 Millions de consommateurs alerte sur 132 médicaments
  49. Saint-Louis : une gramoune de 86 ans rentre de l’hôpital couverte de bleus
  50. Heureux centième anniversaire à Valentine Assoune ! (PHOTOS/VIDEO)
  51. Les époux GRONDIN ont célébré leurs noces d’or !
  52. Des masques pour les gramounes de Ste Marie (REPORTAGE VIDEO)
  53. (VIDEO) Julie Nauche crée 32 cartes pédagogiques pour sensibiliser les plus jeunes aux bienfaits du Yoga
  54. Yoga : Julie Nauche crée son site pour votre bien-être
  55. Des produits à base de mourong : elle lance sa boite malgré le confinement
  56. Laurence Diss conseille « le bien-être et l’humeur positive » via le sport et l’hygiène alimentaire
  57. Saint-Leu : Salon des cavistes indépendants à la Maison du Coco
  58. Régal a li, le vendredi : découvrez la recette des Pancakes de la Plaine
  59. Régal a li, le vendredi : découvrez la recette de magret de canard au tangor
  60. Régal a li, le vendredi : découvrez la recette de la Tarte Bananaccino
  61. Université de la Réunion : encore plus d’étudiants internationaux cette année malgré le contexte saniraire
  62. Le service civique fête ses 10 ans : une journée spéciale le samedi 17 octobre
  63. La 2ème édition “BD & Manga Péi en folie” bat son plein à la FNAC
  64. Le Campus digital Crealise a fait sa rentrée !
  65. Cinéma : on va voir quoi cette semaine du 14 octobre ?
  66. CinéPalmes : une matinée marmailles avec “Les Trolls 2” ce samedi 17 octobre
  67. Cinéma : on va voir quoi ce week-end ?
  68. Église 2.0: cinéma en plein air ce soir à Ste Marie
  69. “Game of Thrones”, “Un gars, une fille”… Quelles sont les séries préférées des Français ?
  70. The Boys : notre coup de coeur série du mois de septembre
  71. Lucifer : notre coup de coeur série du mois d’août
  72. Les Demoiselles du Téléphone : notre coup de coeur série du mois
  73. TSIZIVAY
  74. fontaine Paul Vincent
  75. LE MARAICHERS de chamborne
  76. Trouver un chien
  77. portable perdu trou d’eau
  78. Perdu chat
  79. VOL SAC A MAIN
  80. Perte/vol de portefeuille
  81. CISE
  82. SUDEAU
  83. Entre-Deux: interruption de la distribution en eau le jeudi 22 octobre
  84. Salazie : des coupures de nuit sont programmées à partir de 20h
  85. Saint-Benoit: interruption de la distribution en eau le 28 octobre
  86. Saint André : des coupures d’eau à partir de ce soir
  87. Professeur tué : Gérald Darmanin annonce des opérations de police en cours
  88. Des jeunes ont bloqué l’accès aux locaux de la CINOR
  89. Coronavirus : l’agent pathogène survit neuf heures sur la peau
  90. Vingt jeunes réunionnais s’engagent dans l’armée de Terre
  91. Distribution en eau interrompue sur Cilaos – Bras Sec
  92. Le16e Congrès des Régions de France ce lundi
  93. Coronavirus: fin de l’Etat d’urgence sanitaire à Madagascar
  94. Salazie : des coupures de nuit sont programmées à partir de 20h
  95. Témoignage : “on a volé du scorie sur la tombe d’un de mes proches”
  96. Eliminée de Koh Lanta, Hadja confie que Bertand-Kamal était son soleil dans l’aventure

H3 Headings

29 :
  1. L'actualité de la Réunion en direct
  2. L’ÉPIDÉMIE FLAMBE, ÇA DEVIENT INQUIÉTANT, PROTÉGEZ-VOUS !
  3. Actualités
  4. Vidéos
  5. Actus collectivités
  6. Entendu sur Free Dom
  7. Musique Péï
  8. Ça fait le buzz
  9. Loisirs
  10. Petites annonces
  11. Espace Services
  12. Articles qui pourraient vous intéresser
  13. Eliminée de Koh Lanta, Hadja confie que Bertand-Kamal était son soleil dans l’aventure
  14. Un aventurier de Koh-Lanta rejoint Danse avec les stars
  15. Koh-Lanta : une cérémonie d’adieu à Bertrand-Kamal
  16. À ne pas manquer
  17. Edito de Yves Montrouge
  18. « Covid-19, un bébête la nuit’ ça ! »
  19. BERKEY
  20. KN95/FFP2
  21. Petites annonces
  22. Facebook
  23. Twitter
  24. Instagram
  25. Courriers des lecteurs
  26. FDGR: “L’éducation nationale sous le choc!”
  27. Manapany, L’Hermitage : les mobilisations citoyennes montrent l’attachement des Réunionnais à leur littoral
  28. Jardins de Manapany : 200 affiches collées dans les rues de Saint-Joseph
  29. Portés disparu

H4 Headings

12 :
  1. Trouvés 19 octobre 2020 TSIZIVAY trouvé cb au non TSIZIVAY a saint Leu 0692 856125 Lire la suite 19 octobre 2020 fontaine Paul Vincent TROUV2 PAPIER AU NON fontaine Paul Vincent a la Ravine Creuse saint André 0692 159259 Lire la suite 19 octobre 2020 LE MARAICHERS de chamborne Trouvé chèque au non LE MARAICHERS de chamborne au cimetiere de saint André 0692 618848 Lire la suite 19 octobre 2020 Trouver un chien Trouver un chien dans le chemin Stéphane ravine des cabris. C’est un chosso la race du chien, il a un collier et une médaille avec un numéro d’immatriculation je crois. Pour le récupérer veillée fournie toute les papiers lui concernant, comme preuve qu’il vous appartient. Sinon je l’emmène chez un vétérinaire pour trouver son propriétaire.… Lire la suite Perdus 19 octobre 2020 portable perdu trou d’eau Bonjour à tous, J’ai perdu mon portable sur la plage de trou d’eau samedi soir. C’est un crosscall noir. Merci pour votre aide Lire la suite 19 octobre 2020 Perdu chat J’ai perdu mon chat Savanna (de race bengal).Taille moyenne, tricolore (noir,gris, marron caramel), yeux clair couleur jaune vert.Elle est très familière et aime se cacher. Secteur saint Pierre jolie fond. Si vous la voyez svp contactez moi . Lire la suite 19 octobre 2020 VOL SAC A MAIN Bonjour, Je me suis fait voler, jeudi 16 octobre à Saint Pierre mon sac à main en cuir avec mon portefeuille (carte bleue, carte vitale, permis de conduire à mon nom : Léa ROUSSEAU), mes lunettes de soleil de vue (noires, marque CARRERA), mes clés, etc. Lire la suite 19 octobre 2020 Perte/vol de portefeuille Bonjour à Zot, Je cherche mon portefeuille notamment le contenue du portefeuille Carte identité permis de conduire , carte bancaire ,… perdu au niveau du restaurant la mer cassée à saint Philipe. Portefeuille Brun en faux cuir Merci de me contacter au 0693 62 93 83 Cordialement , Teziti Faissal Lire la suite
  2. Perdus 19 octobre 2020 portable perdu trou d’eau Bonjour à tous, J’ai perdu mon portable sur la plage de trou d’eau samedi soir. C’est un crosscall noir. Merci pour votre aide Lire la suite 19 octobre 2020 Perdu chat J’ai perdu mon chat Savanna (de race bengal).Taille moyenne, tricolore (noir,gris, marron caramel), yeux clair couleur jaune vert.Elle est très familière et aime se cacher. Secteur saint Pierre jolie fond. Si vous la voyez svp contactez moi . Lire la suite 19 octobre 2020 VOL SAC A MAIN Bonjour, Je me suis fait voler, jeudi 16 octobre à Saint Pierre mon sac à main en cuir avec mon portefeuille (carte bleue, carte vitale, permis de conduire à mon nom : Léa ROUSSEAU), mes lunettes de soleil de vue (noires, marque CARRERA), mes clés, etc. Lire la suite 19 octobre 2020 Perte/vol de portefeuille Bonjour à Zot, Je cherche mon portefeuille notamment le contenue du portefeuille Carte identité permis de conduire , carte bancaire ,… perdu au niveau du restaurant la mer cassée à saint Philipe. Portefeuille Brun en faux cuir Merci de me contacter au 0693 62 93 83 Cordialement , Teziti Faissal Lire la suite
  3. Share This
  4. Share This
  5. Share This
  6. Share This
  7. Share This
  8. Share This
  9. Share This
  10. Share This
  11. Share This
  12. Share This

H5 Headings

0 :

H6 Headings

6 :
  1. Le 51ème Tour Auto - Rallye de la Réunion annulé ?
  2. Air Caraïbes soutient l'opération Octobre Rose 2020
  3. Le Gouffre : le PGHM recherche Patrick, disparu depuis vendredi
  4. Collectif CAP 2024: « Ensemble contre le grand bond en arrière !
  5. Covid-19 : Bruno Le Maire annonce 20 milliards d’euros pour renforcer les fonds propres des entreprises
  6. "Game of Thrones", "Un gars, une fille"... Quelles sont les séries préférées des Français ?

Total IFRAMEs

1 :

Total Images

129 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-45946729-1

Links - Internal

327:

Links - Internal (nofollow)

0:

Links - Outbound

21:

Links - Outbound (nofollow)

0:

Keyword Cloud for Freedom.fr

ericka bareigtsdidierpour ravirlocaux20205 marsnombrebat son pleinsaintlambertsainterosemedia screenstphane fouassin lurichard nirlograld maillotsaintesuzanne2savoir plussoleilet dutoursuite unepayetsophie arzaljeanluc saintlambertsainterosearzaljeanlucalamelousaintandre joduose rendretourlapossession vanessanotre coupconcept19 octobre 202019na d8217zinvits8220bdsellysabrina raminpatrickdernierquesaintdenisvar clon documentgetelementbyiddiveluscontentclonenodetruemaissearchheaderbuttonpartir22suite 17 octobrescorie surle vendredi dcouvrezcandidatselussecondtourquelles23borderwidthpremier tourcilaoskohlantasont les sriessecondaryclone positionpinterestyves montrougedocumentairesmediamois je vousdocumentgetelementbyidlisteelusappendchildclonhamilcaroetangsale jeanclaude lacouturemathieupostgrid section4chefsque lestrouvavironsimportant hassidebar secondaryclone0692corner lepourles articlesulelinforme ses abonnsmaillotsaintesuzanne maurice gironcelalexandreau premier toursaintlouissrie du moissoncandidat lu au9suitesaintandrfree dom documentairesfleursbareigtsdidier robertsaintemarie richardinforme sesse tientle campusdocumentgetelementbyidcandidatselussecondtourinnerhtml letourcilaos jacques tcherpaulrechercher une annoncepinterest googlesully hoarausaintphilippe oliviertombe d8217undisplaycoeur sriedatasetsyaxestousvideowisectionsection6 widthcesthamilcaroetangsalemaillotsaintesuzanne mauriceau premier tourcilaosmaxtickslimit 50runionjuliana m5cdoihomaclaude hoaraucyriltravauxtourlapossessionalain bnardleport olivierrejoint2me ditionhadjawisectionsection5 wisectionsection6pour ravir vosau premier tourpetiteilemichel vergozbrunofainsaintpaul huguette bellobachilfranaiswidthpatrice sellysabrina raminpatrickle candidatravir vosright100 importantdaniel pausrolandatchapadaniel gonthierjeanhugues ratenonsaintbenoitmaxwidthsecondaryclonedcouvrir monlebreton lu ausaintdenis erickabloggridcolumn4 postgrid section40pxpresse on parlebruno domentroisbassins danielpremier toursaintpierretourlapossession vanessa miranvillephilippefranckyvirapoullbraspanon jeannickrendezvous avec ledom rtrospectivedes coupureswisectionsection3 wisectionsection4 wisectionsection5programmesdehellip lire19 octobre10d8217urgencecheongdaniel alamelousaintandreoptions maintainaspectratio falsepaulticks fontsize ftszposter une annoncemalgrce soirvous faisscreen and maxwidthticks beginatzerojacques tcherpaul tcheroliviertropicaletype barretrouvezloisirs multimdia vhiculesalainemmasearchheaderbutton toppayetsophie arzaljeanlucemissionshoaraucyril hamilcaroetangsaleinformeravir vos papillesulel documentgetelementbyidulcandidatshoarausaintphilippefondoptionsmars 20200 varles vendredispapilles cette semainetoursaintjoseph patrick lebretonericka bareigtsdidier robertsaintemariehieril yvos papillesgrondingonthierjeanhugues ratenonsaintbenoithoarausaintphilippe olivierlebreton lupicardentredeux bachil valyvhiculesu00e9lu auaucunles secteursvarcandidatseluspremiertourvendredisreportagevos papilles cettemarmaillesrobertsalazie stphanepremier toursaintpierre michelsullysaintjosephcommevos chefs prfrsifvillejacquesjeannicknoneproposejo bedierjeanmarieles annonces posterlacouturemathieu hoarauavironsmaintainaspectratio false aspectratiobarperdus emploisuite sharepostermaisonparleblogcontainer bloggridcolumn4 postgridet nicoheureslu aurgions de francehoarau lu aupausroland ramakistinmarie yvelinenicoscalesvaly lu ausurpremier tourtampon12 octobrebruno domentroisbassinssrie aprs littlechartctx typecommunenirlograldplus surposition absolutebrunoy27une recette pourlakane cheongdanieldatapapillesdepuisblogcontainer bloggridcolumn4lireimportant media screenaotceillacouturemathieu hoarauavirons ericdom documentaires interwiewstoursaintjoseph patrickpostgridramakistinmarie yvelineandrvol dusecondscales yaxes tickssasescampussuite 19 octobreeauserge hoaraule campus digitaldocumentaires interwiewsfrancefacebook twitter pinterestpostgrid widthrubriquemaurice gironcelalexandresecitonlist blogcontainermanga pipatricknirlograld maillotsaintesuzanneles sries prfrescette occasionsecteurstombetype bar dataelsetople foodlab8 octobre 2020dehellipcest votreleugeneratedcontent varau premier tourlapossessionservice civiquejulianaavecdu scorie suroctobre 202019false aspectratiodigitalgraldmon coup30 ans tlfvriermesalamelousaintandre jo bedierjeanmariemaxdevicewidthjoratenonsaintbenoit patrice sellysabrinamalia runiontoursaintpierrepostna d8217zinvits freection16interwiewsenfantsabonnsvergozbrunopausroland ramakistinmariecourslistecandidats saintdenis erickawisectionsection6valy luhoaraucyril hamilcaroetangsale jeanclaudeje vous faisbedierjeanmariefaisifmuxaux locauxxaxes tickspausrolandimmobilier maison loisirslu au secondbachil valy17actualitspressetwitterwisectionsection3folie8221 bat sonhoaraucyrilimportantinterwiews emissionsfree dom rtrospectivevillagesehistoire de free28rgionswisectionsection5 wisectionsection6 width7propose den savoirwisectionsection5suite 192020 dessrie dufontaine luwisectionsection4 wisectionsection5johnny payetsophiefais dcouvrirunmairemychart new chartctxdocumentgetelementbyidcandidatselussecondtourinnerhtmlbackgroundcolorbello alainbatpicardentredeux bachilmaison loisirs multimdiajacques tcherpaultourpetiteile sergesection4 secitonlistfree dom franckylu au premiernuit sontsimpledomcoupuresrechercherl8217lerobertsalazie stphane fouassinsecitonlistansniveau202019 octobre 2020fteserge hoarau luchaleur tropicale1 optionsconcept est simplematinefacebook twittertourcilaos jacquesvar ulelaspectratio ratiotrslundicoupures de nuithistoireemploid8217zinvits freectionrendresavoir plus surtwitter pinterest googlefoodlab corner ledisplay noneperdusstphanecampus digital crealisenauchece samedi 17mamindypajanyjean sully hoarausaintphilippeseclistecandidatsans tl freesellysabrina raminpatrick dalleauplainedespalmistesbnardleporttourtampon andr thienahkoonnathaliewidgetmoregeneratedcontentdalleauplainedespalmistesmiranvillephilippe robertsalazie stphanebareigtsdidier robertsaintemarieconfinementhautinlineblock18coeur30 ansdamedigital crealisevanessa miranvillephilippe robertsalazietientmiranvillephilippe robertsalaziebedierjeanmarie virapoullbraspanondanielfontainemaillotsaintesuzannepublishedtoursaintpierre michel fontainexaxes ticks fontsizeactu radiodes franaisdomentroisbassins danielsamedi 17dom histoiresection3 secitonlist blogcontainerpostpostcontentprsidentratiopicandidat25toursaintlouis julianavotes datafolie8221 batsamedis du moisfait le buzzdom rtrospective 30bonjoursamedis dupatrick lebretonolivier hoarau lumontrougetrouversearchboxstyledisplay2 comments facebookchartctx5 xaxessemaine emmaprfresses abonnsdomentroisbassinsmoregeneratedcontent moregeneratedcontent moregeneratedcontentvouspremier toursaintlouis julianamalgr leannonce rechercherpostposttitlefvrier 20205 marsmes proches8221robertsaintemarie richard nirlograldtoursaintjosephditionautodeuxce samediabsolutesainteroseelle20205 mars 2020voirdom franckydatasets labelfainsaintpaulmauricegonthierjeanhuguesdu coronavirusrecette pourrichardsemaine emma etlucassaintleu bruno19 octobre 2020tous les vendredisvhicules facebook twitterclipcette semaine emmagars uneimportant hassidebardocumentaires interwiews emissionsmecinorpar la pressehoarauemma et nicocomptedernierslistecandidats saintdenisjeanclaudeet nico vousgironcelalexandreabsolute importantvanessa miranvillephilippejournauxarzaljeanluc saintlambertsainterose micheld8217eaumychart newradio freejournaux entendurichard nirlograldsection4 secitonlist blogcontainertropicale les annoncesvar ulel documentgetelementbyidulcandidatsbassireune journeoctobre 2020 rgalcise runiontcherolivier picardentredeux bachilmiranvillephilippeoctobreproposent tousmaintainaspectratio falseestcandidat lu24vous fais dcouvrirfnacgeneratedcontent generatedcontent generatedcontentfacebookchartctx type barunevous proposentmunigraphdocumentgetelementbyidcommuneelustourinnerhtmlsuite tousmaxtickslimitmamindypajanyjean sully5 xaxes ticksjeannick atchapadaniel gonthierjeanhuguesmois jeavec le foodlabl8217accsjournaux entendu sur14darmaninsaintpaulpolicejealamelousaintandreraminpatrick dalleauplainedespalmistessries prfres desblogcontainerdcouvrirpatrice sellysabrinavue parcheongdaniel alamelousaintandre joportsecteursimple voscheongdanielimportant wisectionsection3gonthierjeanhugues ratenonsaintbenoit patriceoptions maintainaspectratiocettejeanclaude lacouturemathieuvanessagironcelalexandre lakane cheongdaniel0px importantvuecampus digitalli ledocumentgetelementbyiddiveluscontentclonenodetrue documentgetelementbyidlisteelusappendchildclonfouassin luyaxes ticks beginatzeroborderwidth 1aussians tlanniversaireest simplewisection3 wiblogolivier rivirel8217etatfrancky na d8217zinvitsste mariepatricevar listecandidats saintdenisramakistinmariecorner le conceptpapilles cettechefs prfrs voustrue maxtickslimit 5leursaint andrtl free domaspectratio ratio scalesbras secle buzzcoeur srie aprslucassaintleufreeli le vendredijourpeuventmultimdia vhicules facebookplacesection3share this 2au premier toursaintpierretwitter pinteresttampond8217urgence sanitaired8217un de mesannonces poster unesisaintemarielantafreectiondom free8julieprodli cestcinmadalleauplainedespalmistes johnny payetsophieimportant wisectionsection3 wisectionsection4functionmultimdiale candidat lu20alain bnardleportontvergozbruno mamindypajanyjean sullyclon documentgetelementbyiddiveluscontentclonenodetruevirapoullbraspanonstedes pancakes1michel vergozbruno mamindypajanyjeanmarsm5cdoihomaclaude hoaraucyril hamilcaroetangsalevalypleinrgal a lijeannick atchapadanielratio scales yaxescartebnardleport olivierproches8221dalleauplainedespalmistes johnnysur free domfalse aspectratio ratio2020 la 2mebat sond8217zinvits freection chaleurcette anne618 octobre 2020au premierpremier tourtampon andrtl freelebreton12 octobre 2020vol du scorieannoncespour lesaintlambertsainterose michelle conceptelse varwiblog17 octobre 2020sanitairefontsize ftsz ifvillelemonyaxes ticksson pleinje vous proposesaintphilippemdicamentsdistribution en eausaintesuzannebeginatzero truevendredi dcouvrez13bar databeginatzeromychartbachil valy luvendredicesfemmesmatinciviqueprfrs202019 octobreyoutubesoirdom free dommai 2020ce lundifilmsjo bedierjeanmarie virapoullbraspanonchaleur tropicale lespostedchaleurserviceatchapadaniel8220onramakistinmarie yveline fainsaintpaulcollectivitsxaxeslieuaprs littlemoislittle fires everywhere12dimanchefouassin lu auhoarauavirons eric18 octobreimmobilier maisonpremier tourlapossession vanessavar generatedcontenttypefinrivirewisectionsection4 wisectionsection5 wisectionsection6suite 17eric ferrreroseline lucassaintleupremierferrreroselinefait lethienahkoonnathaliefoodlabmichel fontainejeunessuite tous lessecitonlist blogcontainer bloggridcolumn4bedierjeanmarie virapoullbraspanon jeannicknosu00e9lu au premierpicardentredeuximportant leftrendezvousdu scoriehassidebar secondaryclonepremier tourcilaos jacquestcherpaul tcherolivier picardentredeuxsection4nico vousrentrele samediatchapadaniel gonthierjeanhuguesvous proposeandr thienahkoonnathalietcherpaul tcheroliviertlcoeur srie dunalutrouvs perdus emploiarzaljeanluc saintlambertsainterosepasposted on 1616 octobreftsz ifvillepatrick lebreton lubeginatzero true maxtickslimitmangaradio free domnotrecornerau nonrobertsaintemarie richardmarie4clon documentgetelementbyiddiveluscontentclonenodetrue documentgetelementbyidlisteelusappendchildclonetprfrs vousoliviervotrepostgrid section4 secitonlistinterrompuedu mois je19une annoncefilml8217occasiongrald darmanin8 octobrenewden savoir plusrtrospectivetcherolivier picardentredeuxaot 2020une annonce rechercherannetoursaintlouis juliana m5cdoihomaclaudeau premier toursellysabrinasaintleum5cdoihomaclaudemaintainaspectratiosontsont lesdocumentgetelementbyidcandidatselussecondtourinnerhtml le candidatnouveaufree dom histoirefaitdocumentgetelementbyidulcandidatswisection3yvesrendezvous avecsrie aprsedito de yvesclonrecette pour ravir11dom francky nabaromtrearticlesradio vuebientregeneratedcontent generatedcontentsergepi en folie8221aspectratiohassidebarscreenlorsc8217est unscreen and maxdevicewidthd8217unetourtampon andrthienahkoonnathalie bassiresamedi 17 octobresharel8217accs aux locauxaprsdcouvrir mon coupoctobre 202019 octobreeric ferrreroselinetrouvs perdustourpetiteile serge hoarausemaineles secteurs suivantssur leeverywhere etborderwidth 1 optionsfreection chaleurolivier rivire lucovid19li cest votrewisectionsection4michel fontaine lusuite 3domentroisbassins daniel pausrolandbaromtre journaux entenduentendu surle foodlab corner2020 lelabellors d8217untftsztoursaintlouislabelsdata labelsu00e9luhoarauavirons eric ferrreroselinehoarau lusiteferrreroseline lucassaintleu brunomaurice gironcelalexandre lakaneleftdjquirechercher unele concept estlestcherpaulles annoncesplein la fnacprfres descisepremier toursaintjosephfolie8221maliamoregeneratedcontent moregeneratedcontentdont2 commentsvous proposent tousulelparentnoderemovechildulel varyveline fainsaintpaulrtrospective 30dcouvrezau premier tourtamponsaintlambertsainterose michel vergozbrunofontsizebuzzgalementhoarauavironsravirradioemploi immobilieroprationschienannonce rechercher unecilaossecteurs suivantsdansnechefs prfrssalaziedes jeunesfainsaintpaul huguettecomments facebook twitter2020 covid19hamilcaroetangsale jeanclaudeperduencorefalsemisannonceoprations de policeacturivire ludes oprationsauxfontsize ftszfirescette semaine8220on a volbrasstphane fouassinifpostthumbnail falseratio scalesjoursjeudiquelles sontlittle firespremier tourlapossession2me dition 8220bdtourpetiteileifpostthumbnaildition 8220bdcoup de coeursurhellip lirevergozbruno mamindypajanyjeanvosdu servicefree dom freetoursaintpierre michelportefeuillenombre de votescrealiseposition absolute importantvar listecandidatsfrancky natrollslucifer74 anssamedispremier toursaintlouis9 octobreau premier toursaintjosephimportant mediamultimdia vhicules2meoules sriesproposent tous lesyvelineoctobre 2020 lepublished on 19tourtamponblockprfrs vous proposentannonces posterdocumentgetelementbyiddivelusinnerhtmlsecond tourje vousfoodlab corneravec lewisectionsection3 wisectionsection4kartelentendu sur freebraspanonvolseramamindypajanyjean16 octobre 2020googledistributionimmobilierune recettetous lesc8217estscales yaxesaprs little fireseditole vendrediparle de freesur freesur lespremier toursaintjoseph patrickhoarausaintphilippe olivier rivireradio vue parcontlistgraphvirapoullbraspanon jeannick atchapadanielbnardleport olivier hoarauvnementloisirs multimdiafais dcouvrir monperdus emploi immobilierbellowindowscreenwidthlittlelakanejulie nauchelucassaintleu bruno domentroisbassinsoctobre 2020quelles sont lesimportant toplabel nombrefouassinhuguette bellodom documentairesemploi immobilier maisonscoriepetit26suite 8johnny payetsophie arzaljeanlucsanstropicale lestruegironcelalexandre lakanecoronavirusbello alain bnardleportdu moissimple vos chefsmaison loisirstcheroliviercet vnementvhicules facebooksavoirprofesseurrgal li cestmichelmunicipalesbloggridcolumn4 postgridvar clonrunionnaistaitli10 ansjeanclaude lacouturemathieu hoarauavironsau second toursaintdatasets label nombrebloggridcolumn4 postgrid widthloisirscoupticks beginatzero truesearchboxstyledisplay noneparfvrier 20205surhellipratenonsaintbenoitlacouturemathieubordercolorpremier tourandr thienahkoonnathalie bassire14 octobrelakane cheongdaniel alamelousaintandretourcilaosidcommunefreection chaleur tropicalepremier tourpetiteilemareservicesjuliana m5cdoihomaclaudeentendulimitticks fontsizedenbloggridcolumn4trouvsraminpatrickhuguette bello alainfires everywhereratenonsaintbenoit patricesaintdenis ericka bareigtsdidier3bareigtsdidierest simple vosyveline fainsaintpaul huguette1 options maintainaspectratiovos chefsrtrospective 30 ansnuitnew chartctxsur la tombeifelid8pxoccasionairsuivantsmunigraphcontainerticksavantfires everywhere etgeneratedcontentrgalvous propose denbar data labelssaintlouisrobertsaintemarieulelparentnoderemovechildulelhuguettesully hoarausaintphilippedepuis vendredigarsle samedi 17propose dennirlograld maillotsaintesuzanne mauricejourneoctobre 2020 covid19everywhere17 octobrelire la suitesection3 secitonlistproposentsriecommentscontremaxtickslimit 5 xaxesposted on 19dans lekartel prodfontaine lu aurgal livie13 octobre 2020saintpierrerobertsalazieerickad8217zinvitsdcouvrez la recettemairecetteleurspancakesfree domdocumentgetelementbyidlisteelusstyledisplay13 octobreyoga9 octobre 2020premier tourpetiteile sergetwitter youtubecetericsamediaunew chartctx typeden savoirtous les articlesnonraminpatrick dalleauplainedespalmistes johnnyprfres des franaisdans lesdesbaromtre journauxfacebook twitter youtubejohnnyferrreroseline lucassaintleudocumentgetelementbyiddiveluscontentclonenodetrue2115poster uneval8217accs auxvotestrue maxtickslimitrivire lu aupayetsophieau secondsriesmardiemma etwidth 100 importantd8217undaniel pausroland ramakistinmarieplusconcept estm5cdoihomaclaude hoaraucyril5disparupositionolivier hoarauplainedu2020 rgalsries prfresarrivewidth 100comments facebook

Longtail Keyword Density for Freedom.fr

KeywordsOccurences
lire la suite57
19 octobre 202035
lu au premier27
maintainaspectratio false aspectratio24
le candidat lu24
candidat lu au24
new chartctx type24
chartctx type bar24
false aspectratio ratio24
xaxes ticks fontsize24
options maintainaspectratio false24
ratio scales yaxes24
1 options maintainaspectratio24
borderwidth 1 options24
nombre de votes24
type bar data24
datasets label nombre24
bar data labels24
aspectratio ratio scales24
documentgetelementbyidcandidatselussecondtourinnerhtml le candidat24
scales yaxes ticks24
ticks beginatzero true24
ticks fontsize ftsz24
yaxes ticks beginatzero24
beginatzero true maxtickslimit24
mychart new chartctx24
5 xaxes ticks24
true maxtickslimit 524
maxtickslimit 5 xaxes24
fontsize ftsz ifville23
lu au second18
au second tour18
posted on 1917
generatedcontent generatedcontent generatedcontent16
octobre 2020 le11
facebook twitter pinterest10
twitter pinterest google10
published on 1910
octobre 202019 octobre10
202019 octobre 202010
19 octobre 20201910
suite 19 octobre9
moregeneratedcontent moregeneratedcontent moregeneratedcontent9
comments facebook twitter8
u00e9lu au premier7
blog-container blog-gridcolumn-4 post-grid7
distribution en eau7
16 octobre 20207
seciton-list blog-container blog-gridcolumn-47
hoarau lu au6
au premier tour6
coup de coeur6
tous les articles6
samedi 17 octobre6
screen and max-device-width5
screen and max-width5
francky na d8217zinvits5
suite tous les5
important media screen5
li le vendredi4
le vendredi dcouvrez4
vergozbruno mamindy-pajanyjean sully4
radio free dom4
rgal a li4
13 octobre 20204
coupures de nuit4
20205 mars 20204
17 octobre 20204
entendu sur free4
sur free dom4
octobre 2020 rgal4
immobilier maison loisirs4
maison loisirs multimdia4
emploi immobilier maison4
quelles sont les4
facebook twitter youtube4
posted on 164
12 octobre 20204
prfres des franais4
dcouvrez la recette4
sries prfres des4
les sries prfres4
sont les sries4
blog-gridcolumn-4 post-grid width4
2020 la 2me3
8220on a vol3
vol du scorie3
sur la tombe3
d8217un de mes3
fvrier 20205 mars3
le samedi 173
du scorie sur3
l8217accs aux locaux3
8 octobre 20203
au premier tourtampon3
jacques tcherpaul tcherolivier3
tcherpaul tcherolivier picardentredeux3
tcherolivier picardentredeux bachil3
picardentredeux bachil valy3
bachil valy lu3
valy lu au3
premier tourtampon andr3
pi en folie82213
tourtampon andr thien-ah-koonnathalie3
andr thien-ah-koonnathalie bassire3
var ulel documentgetelementbyidulcandidats3
var clon documentgetelementbyiddiveluscontentclonenodetrue3
clon documentgetelementbyiddiveluscontentclonenodetrue documentgetelementbyidlisteelusappendchildclon3
octobre 2020 covid-193
oprations de police3
2me dition 8220bd3
edito de yves3
folie8221 bat son3
dcouvrir mon coup3
emma et nico3
et nico vous3
9 octobre 20203
ce samedi 173
coeur srie du3
srie du mois3
samedis du mois3
du mois je3
mois je vous3
je vous fais3
vous fais dcouvrir3
fais dcouvrir mon3
coeur srie aprs3
cette semaine emma3
srie aprs little3
aprs little fires3
little fires everywhere3
fires everywhere et3
je vous propose3
vous propose den3
propose den savoir3
den savoir plus3
savoir plus sur3
informe ses abonns3
les secteurs suivants3
share this 23
2 comments facebook3
semaine emma et3
papilles cette semaine3
bat son plein3
le concept est3
plein la fnac3
le campus digital3
campus digital crealise3
18 octobre 20203
fait le buzz3
suite 17 octobre3
rgal li cest3
li cest votre3
rendez-vous avec le3
avec le foodlab3
le foodlab corner3
foodlab corner le3
corner le concept3
concept est simple3
vos papilles cette3
est simple vos3
simple vos chefs3
premier tourcilaos jacques3
vos chefs prfrs3
chefs prfrs vous3
prfrs vous proposent3
vous proposent tous3
proposent tous les3
tous les vendredis3
une recette pour3
recette pour ravir3
pour ravir vos3
ravir vos papilles3
tourcilaos jacques tcherpaul3
lucassaintleu bruno domentroisbassins3
au premier tourcilaos3
important has-sidebar secondary-clone3
perdus emploi immobilier3
loisirs multimdia vhicules3
multimdia vhicules facebook3
vhicules facebook twitter3
section-3 seciton-list blog-container3
blog-gridcolumn-4 post-grid section-43
post-grid section-4 seciton-list3
section-4 seciton-list blog-container3
important wi-sectionsection-3 wi-sectionsection-43
wi-sectionsection-3 wi-sectionsection-4 wi-sectionsection-53
wi-sectionsection-4 wi-sectionsection-5 wi-sectionsection-63
wi-sectionsection-5 wi-sectionsection-6 width3
width 100 important3
position absolute important3
rechercher une annonce3
var listecandidats saintdenis3
listecandidats saintdenis ericka3
saintdenis ericka bareigtsdidier3
ericka bareigtsdidier robertsaintemarie3
bareigtsdidier robertsaintemarie richard3
robertsaintemarie richard nirlograld3
richard nirlograld maillotsaintesuzanne3
nirlograld maillotsaintesuzanne maurice3
maillotsaintesuzanne maurice gironcelalexandre3
maurice gironcelalexandre la-kane3
gironcelalexandre la-kane cheongdaniel3
la-kane cheongdaniel alamelousaintandre3
cheongdaniel alamelousaintandre jo3
alamelousaintandre jo bedierjean-marie3
trouvs perdus emploi3
annonce rechercher une3
bedierjean-marie virapoullbraspanon jeannick3
dom free dom3
histoire de free3
free dom histoire3
radio vue par3
par la presse3
presse on parle3
parle de free3
free dom rtrospective3
dom rtrospective 303
rtrospective 30 ans3
30 ans tl3
ans tl free3
tl free dom3
free dom free3
free dom documentaires3
une annonce rechercher3
dom documentaires interwiews3
documentaires interwiews emissions3
baromtre journaux entendu3
journaux entendu sur3
free dom francky3
dom francky na3
na d8217zinvits freection3
d8217zinvits freection chaleur3
freection chaleur tropicale3
chaleur tropicale les3
tropicale les annonces3
les annonces poster3
annonces poster une3
poster une annonce3
jo bedierjean-marie virapoullbraspanon3
virapoullbraspanon jeannick atchapadaniel3
fouassin lu au3
pausroland ramakistinmarie yveline3
toursaintlouis juliana m5cdoihomaclaude3
juliana m5cdoihomaclaude hoaraucyril3
m5cdoihomaclaude hoaraucyril hamilcaroetangsale3
hoaraucyril hamilcaroetangsale jean-claude3
hamilcaroetangsale jean-claude lacouturemathieu3
jean-claude lacouturemathieu hoarauavirons3
lacouturemathieu hoarauavirons eric3
hoarauavirons eric ferrreroseline3
eric ferrreroseline lucassaintleu3
ferrreroseline lucassaintleu bruno3
bruno domentroisbassins daniel3
domentroisbassins daniel pausroland3
daniel pausroland ramakistinmarie3
ramakistinmarie yveline fainsaintpaul3
au premier toursaintlouis3
yveline fainsaintpaul huguette3
fainsaintpaul huguette bello3
huguette bello alain3
bello alain bnardleport3
alain bnardleport olivier3
bnardleport olivier hoarau3
olivier hoarau lu3
au premier tourlapossession3
premier tourlapossession vanessa3
tourlapossession vanessa miranvillephilippe3
vanessa miranvillephilippe robertsalazie3
miranvillephilippe robertsalazie stphane3
robertsalazie stphane fouassin3
stphane fouassin lu3
premier toursaintlouis juliana3
fontaine lu au3
jeannick atchapadaniel gonthierjean-hugues3
sully hoarausaintphilippe olivier3
atchapadaniel gonthierjean-hugues ratenonsaintbenoit3
gonthierjean-hugues ratenonsaintbenoit patrice3
ratenonsaintbenoit patrice sellysabrina3
patrice sellysabrina raminpatrick3
sellysabrina raminpatrick dalleauplainedespalmistes3
raminpatrick dalleauplainedespalmistes johnny3
dalleauplainedespalmistes johnny payetsophie3
johnny payetsophie arzaljean-luc3
payetsophie arzaljean-luc saint-lambertsainterose3
arzaljean-luc saint-lambertsainterose michel3
saint-lambertsainterose michel vergozbruno3
michel vergozbruno mamindy-pajanyjean3
mamindy-pajanyjean sully hoarausaintphilippe3
hoarausaintphilippe olivier rivire3
michel fontaine lu3
olivier rivire lu3
rivire lu au3
au premier toursaintjoseph3
premier toursaintjoseph patrick3
toursaintjoseph patrick lebreton3
patrick lebreton lu3
lebreton lu au3
au premier tourpetiteile3
premier tourpetiteile serge3
tourpetiteile serge hoarau3
serge hoarau lu3
au premier toursaintpierre3
premier toursaintpierre michel3
toursaintpierre michel fontaine3
rgions de france3
octobre 202084
19 octobre47
lu au45
au premier34
chartctx type24
fontsize ftsz24
ticks fontsize24
5 xaxes24
maxtickslimit 524
true maxtickslimit24
beginatzero true24
ticks beginatzero24
mychart new24
new chartctx24
xaxes ticks24
yaxes ticks24
bar data24
data labels24
datasets label24
label nombre24
votes data24
borderwidth 124
1 options24
options maintainaspectratio24
maintainaspectratio false24
false aspectratio24
aspectratio ratio24
ratio scales24
type bar24
scales yaxes24
le candidat24
documentgetelementbyidcandidatselussecondtourinnerhtml le24
candidat lu24
ftsz ifville23
free dom22
generatedcontent generatedcontent22
second tour19
au second18
facebook twitter15
tous les13
moregeneratedcontent moregeneratedcontent13
2020 le11
202019 octobre10
17 octobre10
octobre 20201910
16 octobre10
twitter pinterest10
media screen10
pinterest google10
suite share10
suite 199
blog-gridcolumn-4 post-grid8
comments facebook8
u00e9lu au7
seciton-list blog-container7
blog-container blog-gridcolumn-47
une annonce6
premier tour6
les articles6
coeur srie6
hoarau lu6
je vous6
kartel prod6
du mois6
samedi 176
payetsophie arzaljean-luc5
ses abonns5
sur les5
na d8217zinvits5
sellysabrina raminpatrick5
ce lundi5
francky na5
suite tous5
pour le5
ce samedi5
dans le5
huguette bello5
dans les5
cette semaine5
sur le5
12 octobre5
important media5
quelles sont4
var generatedcontent4
18 octobre4
var clon4
2020 rgal4
li le4
le vendredi4
vendredi dcouvrez4
des franais4
prfres des4
sries prfres4
les sries4
sont les4
bras sec4
une recette4
gars une4
8 octobre4
aot 20204
13 octobre4
2me dition4
14 octobre4
20205 mars4
cette anne4
mai 20204
suite une4
des jeunes4
julie nauche4
mars 20204
chaleur tropicale4
loisirs multimdia4
il y4
0 var4
post-grid width4
position absolute4
100 important4
twitter youtube4
emploi immobilier4
sur free4
entendu sur4
immobilier maison4
maison loisirs4
var ulel4
d8217urgence sanitaire4
radio free4
important left4
important top4
nuit sont4
atchapadaniel gonthierjean-hugues4
vous propose4
vergozbruno mamindy-pajanyjean4
mamindy-pajanyjean sully4
m5cdoihomaclaude hoaraucyril4
wi-section-3 wi-blog4
ramakistinmarie yveline4
bello alain4
else var4
des pancakes3
mois je3
pour ravir3
samedis du3
se tient3
vol du3
du scorie3
scorie sur3
vous fais3
mes proches82213
srie du3
notre coup3
fvrier 202053
ce soir3
malgr le3
tombe d8217un3
aux locaux3
fais dcouvrir3
savoir plus3
cise runion3
des coupures3
secteurs suivants3
les secteurs3
informe ses3
2020 des3
saint andr3
au non3
plus sur3
den savoir3
dcouvrir mon3
propose den3
everywhere et3
fires everywhere3
little fires3
aprs little3
srie aprs3
l8217accs aux3
mon coup3
service civique3
c8217est un3
son plein3
une journe3
corner le3
ravir vos3
malia runion3
se rendre3
rgal li3
li cest3
cest votre3
rendez-vous avec3
avec le3
le foodlab3
foodlab corner3
le concept3
vos papilles3
concept est3
est simple3
simple vos3
vos chefs3
chefs prfrs3
prfrs vous3
vous proposent3
proposent tous3
les vendredis3
recette pour3
grald darmanin3
ste marie3
suite 33
le samedi3
suite 83
cet vnement3
dition 8220bd3
manga pi3
folie8221 bat3
bat son3
le campus3
campus digital3
digital crealise3
fait le3
le buzz3
9 octobre3
et du3
lors d8217un3
cette occasion3
surhellip lire3
nico vous3
suite 173
et nico3
emma et3
du service3
dehellip lire3
semaine emma3
papilles cette3
des oprations3
tourlapossession vanessa3
10 ans3
var listecandidats3
wi-sectionsection-3 wi-sectionsection-43
wi-sectionsection-4 wi-sectionsection-53
wi-sectionsection-5 wi-sectionsection-63
wi-sectionsection-6 width3
width 1003
important has-sidebar3
has-sidebar secondary-clone3
secondary-clone position3
absolute important3
0px important3
depuis vendredi3
du coronavirus3
74 ans3
ulelparentnoderemovechildulel var3
listecandidats saintdenis3
section-4 seciton-list3
gironcelalexandre la-kane3
virapoullbraspanon jeannick3
bedierjean-marie virapoullbraspanon3
jo bedierjean-marie3
alamelousaintandre jo3
cheongdaniel alamelousaintandre3
la-kane cheongdaniel3
maurice gironcelalexandre3
saintdenis ericka3
maillotsaintesuzanne maurice3
nirlograld maillotsaintesuzanne3
richard nirlograld3
robertsaintemarie richard3
bareigtsdidier robertsaintemarie3
ericka bareigtsdidier3
important wi-sectionsection-33
post-grid section-43
gonthierjean-hugues ratenonsaintbenoit3
journaux entendu3
actu radio3
dom histoire3
radio vue3
vue par3
dom rtrospective3
rtrospective 303
30 ans3
ans tl3
tl free3
dom free3
dom documentaires3
documentaires interwiews3
interwiews emissions3
baromtre journaux3
dom francky3
section-3 seciton-list3
trouvs perdus3
searchboxstyledisplay none3
searchheaderbutton top3
display none3
vhicules facebook3
multimdia vhicules3
perdus emploi3
rechercher une3
d8217zinvits freection3
annonce rechercher3
poster une3
annonces poster3
les annonces3
tropicale les3
freection chaleur3
jeannick atchapadaniel3
ratenonsaintbenoit patrice3
que les3
tourcilaos jacques3
pausroland ramakistinmarie3
yveline fainsaintpaul3
fainsaintpaul huguette3
alain bnardleport3
bnardleport olivier3
olivier hoarau3
premier tourlapossession3
yves montrouge3
vanessa miranvillephilippe3
miranvillephilippe robertsalazie3
robertsalazie stphane3
stphane fouassin3
fouassin lu3
premier tourcilaos3
jacques tcherpaul3
domentroisbassins daniel3
thien-ah-koonnathalie bassire3
2020 covid-193
ifpostthumbnail false3
generatedcontent var3
documentgetelementbyiddiveluscontentclonenodetrue documentgetelementbyidlisteelusappendchildclon3
clon documentgetelementbyiddiveluscontentclonenodetrue3
ulel documentgetelementbyidulcandidats3
andr thien-ah-koonnathalie3
tcherpaul tcherolivier3
tourtampon andr3
premier tourtampon3
valy lu3
bachil valy3
picardentredeux bachil3
tcherolivier picardentredeux3
daniel pausroland3
bruno domentroisbassins3
patrice sellysabrina3
premier tourpetiteile3
raminpatrick dalleauplainedespalmistes3
dalleauplainedespalmistes johnny3
johnny payetsophie3
arzaljean-luc saint-lambertsainterose3
saint-lambertsainterose michel3
michel vergozbruno3
sully hoarausaintphilippe3
hoarausaintphilippe olivier3
olivier rivire3
rivire lu3
premier toursaintjoseph3
toursaintjoseph patrick3
patrick lebreton3
lebreton lu3
tourpetiteile serge3
lucassaintleu bruno3
hoaraucyril hamilcaroetangsale3
ferrreroseline lucassaintleu3
eric ferrreroseline3
hoarauavirons eric3
lacouturemathieu hoarauavirons3
jean-claude lacouturemathieu3
hamilcaroetangsale jean-claude3
juliana m5cdoihomaclaude3
serge hoarau3
toursaintlouis juliana3
premier toursaintlouis3
fontaine lu3
michel fontaine3
toursaintpierre michel3
premier toursaintpierre3
2 comments3
octobre120
le119
0100
les76
au76
var65
suite64
et64
des63
lire57
du53
data48
ticks48
147
sur46
lu45
une43
est40
important39
generatedcontent35
premier35
233
un33
false30
pour29
posted28
dans28
tour27
ftsz27
ratio27
idcommune27
326
commune26
documentgetelementbyiddivelusinnerhtml26
cette26
label25
ce25
candidat25
ifelid24
new24
ifville24
documentgetelementbyidcommuneelustourinnerhtml24
documentgetelementbyidcandidatselussecondtourinnerhtml24
chartctx24
mychart24
votes24
type24
backgroundcolor24
bordercolor24
nombre24
borderwidth24
options24
maintainaspectratio24
aspectratio24
scales24
yaxes24
beginatzero24
true24
maxtickslimit24
xaxes24
datasets24
fontsize24
labels24
bar24
dom22
free22
son21
vous20
second19
moregeneratedcontent19
ans19
se18
runion17
que17
facebook16
twitter15
tous15
qui15
width14
413
par13
avec13
plus12
je12
ont12
ses12
sont12
jeunes11
samedi11
510
pinterest10
610
screen10
annonce10
t10
vos10
published10
media10
share10
mon10
srie10
google10
d8217un10
710
top10
radio10
left10
saint9
sa9
notre9
89
distribution9
secondary-clone9
c8217est9
fait9
il9
andr9
none9
position9
blog-gridcolumn-48
semaine8
depuis8
98
comments8
aux8
dj8
bello8
recette8
vendredi8
hoarau8
post-grid8
elle8
blog-container7
107
117
service7
services7
u00e9lu7
eau7
articles7
salazie7
cilaos7
tampon7
seciton-list7
mois7
li7
function7
rgal7
127
voir6
lors6
kartel6
prod6
coup6
136
coeur6
partir6
michel6
olivier6
cest6
runionnais6
votre6
146
saint-denis6
ces6
nouveau6
fontaine6
cise6
covid-196
max-width6
display6
else6
coronavirus6
histoire6
sanitaire6
mare6
annonces6
lundi6
156
coupures6
ne5
patrick5
propose5
vnement5
va5
cinma5
compte5
dition5
dcouvrez5
searchheaderbutton5
non5
sries5
heures5
mes5
village5
jours5
165
bruno5
max-device-width5
clon5
block5
rendez-vous5
loisirs5
perdu5
video5
175
maison5
185
police5
emploi5
abonns5
huguette5
aot5
perdus5
trouvs5
mars5
yoga5
portefeuille5
arzaljean-luc5
plein5
aprs5
digital5
sellysabrina5
raminpatrick5
payetsophie5
vergozbruno5
bareigtsdidier5
plaine5
na5
retrouvez5
miranvillephilippe5
francky5
freection5
saint-joseph5
d8217zinvits5
bras-panon5
contre5
thien-ah-koonnathalie5
quelles5
rejoint5
saintdenis5
maurice5
nuit5
pas5
saint-andr5
valy5
leurs5
sainte-marie5
194
absolute4
franais4
gars4
prfres4
air4
maire4
tait4
cours4
right4
0px4
presse4
youtube4
galement4
anne4
malgr4
rgions4
dimanche4
collectivits4
manga4
pi4
dont4
204
rentre4
clip4
deux4
lanta4
hadja4
ou4
tropicale4
encore4
vue4
multimdia4
wi-section-34
cinor4
fte4
immobilier4
trs4
derniers4
rechercher4
entendu4
wi-blog4
mdicaments4
bras4
sec4
214
2me4
224
lieu4
vol4
searchboxstyledisplay4
234
comme4
atchapadaniel4
ramakistinmarie4
lacouturemathieu4
hoaraucyril4
m5cdoihomaclaude4
lebreton4
sully4
gonthierjean-hugues4
stphane4
bedierjean-marie4
yveline4
cheongdaniel4
gironcelalexandre4
avirons4
dcouvrir4
mai4
mardi4
carte4
y4
france4
d8217urgence4
mamindy-pajanyjean4
soir4
saint-louis4
ulel4
fin4
nauche4
munigraph4
trouv4
saint-leu4
post4
documentgetelementbyidlisteelusstyledisplay4
chaleur4
ifmux4
fouassin4
alain4
julie4
dehellip3
fais3
jeudi3
vie3
samedis3
fires3
d8217eau3
mais3
little3
l8217etat3
everywhere3
lucifer3
den3
savoir3
d8217une3
surhellip3
secteur3
chien3
occasion3
trouver3
koh-lanta3
243
bonjour3
fond3
films3
film3
grondin3
concept3
corner3
hier3
foodlab3
rendre3
petit3
me3
informe3
malia3
rubrique3
avant3
confinement3
travaux3
secteurs3
site3
suivants3
programmes3
enfants3
marie3
ste3
simple3
chefs3
soleil3
l8217occasion3
trolls3
peuvent3
matine3
sans3
niveau3
dernier3
bien-tre3
place3
prsident3
cet3
prfrs3
jour3
aussi3
253
fleurs3
nico3
emma3
papilles3
ravir3
vendredis3
proposent3
06923
actualits3
femmes3
patrice3
ulelparentnoderemovechildulel3
inline-block3
listecandidats3
ericka3
robertsaintemarie3
richard3
nirlograld3
maillotsaintesuzanne3
la-kane3
alamelousaintandre3
jo3
virapoullbraspanon3
jeannick3
ratenonsaintbenoit3
dalleauplainedespalmistes3
munigraphcontainer3
johnny3
saint-lambertsainterose3
hoarausaintphilippe3
rivire3
toursaintjoseph3
tourpetiteile3
serge3
toursaintpierre3
toursaintlouis3
juliana3
hamilcaroetangsale3
jean-claude3
hoarauavirons3
eric3
contlistgraph3
paul3
lucassaintleu3
vhicules3
municipales3
edito3
yves3
montrouge3
actu3
parle3
rtrospective3
tl3
documentaires3
interwiews3
emissions3
baromtre3
journaux3
poster3
section-33
dame3
section-43
wi-sectionsection-33
wi-sectionsection-43
wi-sectionsection-53
wi-sectionsection-63
has-sidebar3
8px3
widget3
auto3
l8217le3
263
professeur3
273
matin3
ferrreroseline3
domentroisbassins3
sera3
proches82213
l8217accs3
locaux3
anniversaire3
marmailles3
reportage3
pancakes3
interrompue3
leu3
mis3
tient3
283
8220on3
scorie3
tombe3
leur3
darmanin3
fvrier3
nos3
civique3
journe3
8220bd3
folie82213
bat3
fnac3
campus3
crealise3
buzz3
si3
arrive3
duo3
oprations3
grald3
daniel3
documentgetelementbyidulcandidats3
pausroland3
fainsaintpaul3
bnardleport3
tourlapossession3
vanessa3
robertsalazie3
tourcilaos3
jacques3
tcherpaul3
tcherolivier3
picardentredeux3
bachil3
tourtampon3
bassire3
documentgetelementbyiddiveluscontentclonenodetrue3
disparu3
candidatselussecondtour3
port3
saint-paul3
saint-pierre3
saint-philippe3
sainte-rose3
sainte-suzanne3
candidatseluspremiertour3
documentgetelementbyidlisteelusappendchildclon3
aucun3
postpostcontent3
postposttitle3
ifpostthumbnail3
limit3
windowscreenwidth3
haut3

Who hosts Freedom.fr?

Freedom.fr Hosting Provider Information

Hosted IP Address:104.24.102.163
Hosted Hostname:104.24.102.163
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
CloudFlare, Inc.
1.2769%

HTTP Header Analysis for Freedom.fr

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 19 Oct 2020 13:15:06 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Mon, 19 Oct 2020 14:15:06 GMT
Location: https://freedom.fr/
cf-request-id: 05e298dfab0000e67ced99e000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1603113306"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5e4ac412aa34e67c-LHR

Freedom.fr Domain Nameserver Information

HostIP AddressCountry
joel.ns.cloudflare.com 173.245.59.184
meera.ns.cloudflare.com 173.245.58.195


Need to find out who hosts Freedom.fr?


Domain Registration (WhoIs) information for Freedom.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [64.227.39.39 REQUEST] >> freedom.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: freedom.fr
status: ACTIVE
hold: NO
holder-c: FDS95-FRNIC
admin-c: N2190-FRNIC
tech-c: GR283-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL171918-FRNIC
registrar: GANDI
Expiry Date: 2024-05-11T08:39:09Z
created: 1998-11-16T23:00:00Z
last-update: 2020-04-02T05:53:39Z
source: FRNIC

ns-list: NSL171918-FRNIC
nserver: joel.ns.cloudflare.com
nserver: meera.ns.cloudflare.com
source: FRNIC

registrar: GANDI
type: Isp Option 1
address: 63-65 boulevard Massena
address: 75013 PARIS
country: FR
phone: +33 1 70 37 76 61
fax-no: +33 1 43 73 18 51
e-mail: Login to show email
https://www.gandi.net/fr/tlds/fr/
anonymous: NO
registered: 2004-03-09T12:00:00Z
source: FRNIC

nic-hdl: FDS95-FRNIC
type: ORGANIZATION
contact: FREE DOM
address: 131, rue Jules Auber
address: B.P. 666
address: 97400 Saint Denis Cedex
country: RE
phone: +262 692130007
e-mail: Login to show email
GANDI
changed: 2016-09-14T07:44:42Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: N2190-FRNIC
type: ORGANIZATION
contact: NETWORKS
address: NETWORKS
address: 64 RUE VILLEROY
address: 69003 LYON
country: FR
phone: +33.951738738
fax-no: +33.478607961
e-mail: Login to show email
GANDI
changed: 2019-11-26T16:21:12Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: GR283-FRNIC
type: ROLE
contact: GANDI ROLE
address: Gandi
address: 15, place de la Nation
address: 75011 Paris
country: FR
e-mail: Login to show email
-------------------------------------------------
trouble: GANDI is an ICANN accredited registrar
trouble: for more information:
trouble: Web: http://www.gandi.net
trouble: -------------------------------------------------
trouble: - network troubles: Login to show email
- SPAM: Login to show email
-------------------------------------------------
admin-c: NL346-FRNIC
tech-c: NL346-FRNIC
tech-c: TUF1-FRNIC
notify: Login to show email
GANDI
changed: 2006-03-03T14:39:12Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Freed-art.net
Félicitations ! Votre domaine a bien été créé chez OVH !
Freed-company.com
Site is undergoing maintenance
Freed-home-camper.com
Location de van aménagé à Paris Toulouse Angoulême - Freedom Camper
Freed-home-camper.info
Félicitations ! Votre domaine a bien été créé chez OVH !
Freed-home-camper.org
Félicitations ! Votre domaine a bien été créé chez OVH !
Freed-jp.com
无遮无挡丝瓜视频香蕉_香蕉大人在线观看_一本大道在线直播
Freed-learning.com
Befreites Lernen - STARTSEITE
Freed-life.com
Website Powered by TMDHosting
Freed-motion.com
freed-motion.com

Recently Updated Websites

Pumplogmax.space (1 second ago.)Ccwheres.xyz (2 seconds ago.)Naagaios13.space (2 seconds ago.)200337756.xyz (4 seconds ago.)Copperislandacademy.org (6 seconds ago.)Homesolar.expert (7 seconds ago.)Empoweringdoula.info (8 seconds ago.)De47484950.xyz (8 seconds ago.)Cybermafia.tech (9 seconds ago.)Domaincontrolco.xyz (11 seconds ago.)Ssdactivewear.store (11 seconds ago.)Sosilki.shop (12 seconds ago.)Nonaccumsk.xyz (12 seconds ago.)Accesspanels.shop (13 seconds ago.)Ahealthyu.today (13 seconds ago.)Jbgroup.online (13 seconds ago.)Qfruiti.online (14 seconds ago.)Fivegeese.org (14 seconds ago.)Umatteratut.org (15 seconds ago.)Lbta.fun (16 seconds ago.)Daoudeyecare.org (16 seconds ago.)Ansleyexporter.space (16 seconds ago.)Exclusiveugg.xyz (16 seconds ago.)Neusoul.photos (18 seconds ago.)Shinosprem.xyz (18 seconds ago.)Sussexsaxongroup.tech (19 seconds ago.)Entitled.monster (19 seconds ago.)Lighthouseretreat.org (21 seconds ago.)Akthai.org (21 seconds ago.)Best-stock-trader.rocks (22 seconds ago.)

Recently Searched Keywords

her mouth (4 seconds ago.)korea capital pin code (5 seconds ago.)horny daddy (6 seconds ago.)caucasian mountain chiffchaff (7 seconds ago.)elit proin tristique (8 seconds ago.)determine (10 seconds ago.)ronaldo  (11 seconds ago.)หวยฮานอย (12 seconds ago.)денисъ евгеньевичъ (13 seconds ago.)прокат авто в турции (14 seconds ago.)provident metals blog (14 seconds ago.)security jobs (18 seconds ago.)alex ranarivelo (19 seconds ago.)zillow london (20 seconds ago.)umpires - general information (23 seconds ago.)my information in english (24 seconds ago.)precio para construcción y mantenimiento de piscinas en lleida (24 seconds ago.)new tab url (25 seconds ago.)army national (25 seconds ago.)fr die (26 seconds ago.)speedwagon (26 seconds ago.)versand und lieferung (27 seconds ago.)memleketinden gelsin (27 seconds ago.)locationreload (28 seconds ago.)sa (29 seconds ago.)relaciones (29 seconds ago.)0style-kgj326egroot stylablehorizontalmenu4089050981menuitemhorizontalmenuitem2191703659--ishoveredborder-radius0border0 (31 seconds ago.)neuf (34 seconds ago.)0style-kgj326egroot stylablehorizontalmenu4089050981menuitemhorizontalmenuitem2191703659--ishoveredborder-radius0border0 (35 seconds ago.)flower beach (36 seconds ago.)