Friatider.se  |  Fria Tider | Mediesverige behöver en rak höger
Low trust score  | 



Friatider.se Website Information

Website Ranks & Scores for Friatider.se

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:24,821
Majestic Rank Majestic Rank:94,479
Domain Authority Domain Authority:54%
DMOZ DMOZ Listing:No

Domain Information for Friatider.se

Domain Registrar: NIC-SE
Registration Date:2009-12-07  9 years 3 months 1 week ago
Expiration Date:2015-12-07  3 years 3 months 1 week ago

Whois information for friatider.se

Full Whois Lookup for Friatider.se Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Friatider.se. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: friatider.se
holder: BZLSIC9061-53094
admin-c: -
tech-c: -
billing-c: -
created: 2009-12-07
modified: 2016-10-18
expires: 2020-12-07
transferred: 2014-11-18
nserver: ns1.nameisp.info
nserver: ns2.nameisp.info
dnssec: unsigned delegation
status: ok
registrar: www.NameSRS.com

Who hosts Friatider.se?

Friatider.se is hosted by LeaseWeb Netherlands B.V. in Noord-holland, Amsterdam, Netherlands, 1089.
Friatider.se has an IP Address of 95.211.153.74 and a hostname of friatider.se and runs nginx/1.6.2 web server.



Friatider.se Web Server Information

Hosted IP Address:95.211.153.74
Hosted Hostname:friatider.se
Service Provider:LeaseWeb Netherlands B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.374
Location Longitude:4.88969
Webserver Software:nginx/1.6.2

HTTP Header Analysis for Friatider.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.6.2
Content-Type: text/html; charset=utf-8
X-Powered-By: PHP/5.3.3
Etag: "1434317705-1"
Content-Language: sv
X-Generator: Drupal 7 (http://drupal.org)
Cache-Control: public, max-age=86400
Last-Modified: Sun, 14 Jun 2015 21:35:05 GMT
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Content-Encoding: gzip
X-Drupal-TTL: 300.000
X-Varnish-Grace: 86313600.000
Transfer-Encoding: chunked
Date: Sun, 14 Jun 2015 21:36:41 GMT
X-Varnish: 1460306533 1460298236
Age: 96
Via: 1.1 varnish
Connection: keep-alive
Vary: Accept-Encoding, Cookie
X-Varnish-Cache: HIT


Need to find out who hosts Friatider.se?

Friatider.se Free SEO Report

Website Inpage Analysis for Friatider.se

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Friatider.se

flaggstngenframfrroriginal imagejqueryimagemagnifymagnify imgrefreturnoptionssergels torgvityskajqueryimagemagnifymagnify imgref optionsmott baconkommer inteimageskapsigavattidimgrefsoriginaltredjepolisenvillperp sergels torgsomkommerifbaconkritikjsfrgripenochp sergelssinbastubadarefunctionjqueryimagemagnifymagnifytruedetjagnrmuslimermariatfrnquotvifjsintemedflaggstngen pommordtorgsergelsimgref optionsvarmantillflaggstngen p sergels

Longtail Keyword Density for Friatider.se

KeywordsOccurences
jqueryimagemagnifymagnify imgref options3
p sergels torg3
flaggstngen p sergels3
original image3
jqueryimagemagnifymagnify imgref3
imgref options3
sergels torg3
p sergels3
kommer inte3
flaggstngen p3
t bacon3
var20
p15
fr12
till10
if10
och10
det9
med8
ska8
image8
s8
av8
att7
sig6
inte6
vill6
r5
id5
om5
return5
som5
polisen4
mot4
gripen4
function4
man4
true4
options4
fjs4
js4
tredje3
imgref3
bastubadare3
per3
original3
jqueryimagemagnifymagnify3
kommer3
t3
bacon3
framfr3
nr3
kritik3
vi3
tyska3
muslimer3
maria3
frn3
flaggstngen3
sergels3
jag3
mord3
sin3
quotvi3
torg3

What are the nameservers for friatider.se?

Friatider.se Domain Nameserver Information

HostIP AddressCountry
ns1.loopia.se 93.188.0.20Sweden Sweden
ns2.loopia.se 93.188.0.21Sweden Sweden

Friatider.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Friatider.se is a scam?