Fuer-echte-kaufleute.de  |  403 Forbidden
Low trust score  | 

Fuer-echte-kaufleute.de Website Information

Fuer-echte-kaufleute.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 556,014, a Majestic Rank of 0, a Domain Authority of 37% and is not listed in DMOZ.

Fuer-echte-kaufleute.de is hosted by arvato Systems GmbH in North Rhine-westphalia, Rheda, Germany, 33378.
Fuer-echte-kaufleute.de has an IP Address of 109.235.141.134 and a hostname of 109.235.141.134.

The domain fuer-echte-kaufleute.de was registered 201 decades 9 years 1 week ago by , it was last modified 1 decade 1 year 8 months ago and currently is set to expire 201 decades 9 years 1 week ago.


Whois information for fuer-echte-kaufleute.de

Full Whois Lookup for Fuer-echte-kaufleute.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: fuer-echte-kaufleute.de
Nserver: dns009.arvato-systems.de
Nserver: dns017.arvato-systems.de
Nserver: ns1.arvato-systems.de
Nserver: ns2.arvato-systems.de
Status: connect
Changed: 2014-07-01T11:26:08+02:00

[Tech-C]
Type: PERSON
Name: Hostmaster
Organisation: arvato systems GmbH
Address: An der Autobahn 200
PostalCode: 33333
City: Guetersloh
CountryCode: DE
Phone: +49 5241 808000
Fax: +49 5241 8068000
Email: Login to show email
2017-01-09T17:15:19+01:00

[Zone-C]
Type: PERSON
Name: Hostmaster
Organisation: arvato systems GmbH
Address: An der Autobahn 200
PostalCode: 33333
City: Guetersloh
CountryCode: DE
Phone: +49 5241 808000
Fax: +49 5241 8068000
Email: Login to show email
2017-01-09T17:15:19+01:00

Who hosts Fuer-echte-kaufleute.de?

Fuer-echte-kaufleute.de Web Server Information

Hosted IP Address:109.235.141.134
Hosted Hostname:109.235.141.134
Service Provider:arvato Systems GmbH
Hosted Country:GermanyDE
Location Latitude:51.8497
Location Longitude:8.3002
Webserver Software:Not Applicable

HTTP Header Analysis for Fuer-echte-kaufleute.de

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Server: nginx
Date: Wed, 26 Aug 2015 05:19:20 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip


Need to find out who hosts Fuer-echte-kaufleute.de?

Fuer-echte-kaufleute.de Free SEO Report

Website Inpage Analysis for Fuer-echte-kaufleute.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Fuer-echte-kaufleute.de

sindtraditionunsereunssrcbbei aldi nordimvonwiemwmachenvarfrgenausoaldi nordjobsdiezunordderbei aldisieaufbeifreueneinfachalsesaldiihrewirsrcaplayerattrsrckarrierebereine

Longtail Keyword Density for Fuer-echte-kaufleute.de

KeywordsOccurences
bei aldi nord5
bei aldi11
aldi nord9
aldi19
bei15
sie14
wir11
die10
der10
nord9
uns7
ber7
fr6
es6
eine5
als5
unsere4
mw4
im4
wie4
einfach4
srcb4
sind4
jobs4
srca4
ihre4
playerattrsrc3
zu3
var3
freuen3
von3
karriere3
auf3
genauso3
machen3
tradition3

What are the nameservers for fuer-echte-kaufleute.de?

Fuer-echte-kaufleute.de Domain Nameserver Information

HostIP AddressCountry
dns009.arvato-systems.de 193.189.249.157Germany Germany
dns017.arvato-systems.de 84.17.190.100Germany Germany
ns1.arvato-systems.de 84.17.168.68Germany Germany
ns2.arvato-systems.de 109.235.143.148Germany Germany

Fuer-echte-kaufleute.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Fuer-echte-kaufleute.de is a scam?