Funkbone.nu

Website Thumbnail
Checking...
Funk it up! Musiker med fötterna kvar på jorden - Musik & livet

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-17
Category: This site has not been categorized yet

Musik & livet


Domain summary

Domain label
funkbone
Domain extension
nu
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is funkbone.nu ranked relative to other sites:

Percentage of visits to funkbone.nu from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Funkbone.nu registered?
A: Funkbone.nu was registered 1 month, 1 week, 3 days, 5 hours, 20 minutes, 29 seconds ago on Saturday, October 17, 2020.
Q: When was the WHOIS for Funkbone.nu last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 3 days, 5 hours, 20 minutes, 29 seconds ago on Saturday, October 17, 2020.
Q: What are Funkbone.nu's nameservers?
A: DNS for Funkbone.nu is provided by the following nameservers:
  • ns6.binero.se
  • ns5.binero.se
  • ns4.binero.se
  • ns7.binero.se
  • ns3.binero.se
Q: Who is the registrar for the Funkbone.nu domain?
A: The domain has been registered at .NU Domain, Ltd.
Q: What is the traffic rank for Funkbone.nu?
A: Funkbone.nu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Funkbone.nu each day?
A: Funkbone.nu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Funkbone.nu resolve to?
A: Funkbone.nu resolves to the IPv4 address 159.253.219.86.
Q: In what country are Funkbone.nu servers located in?
A: Funkbone.nu has servers located in the Sweden.
Q: What webserver software does Funkbone.nu use?
A: Funkbone.nu is powered by Apache webserver.
Q: Who hosts Funkbone.nu?
A: Funkbone.nu is hosted by Availo Networks AB in Sweden.
Q: How much is Funkbone.nu worth?
A: Funkbone.nu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Funkbone.nu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Funkbone.nu Free SEO Report

Website Inpage Analysis for Funkbone.nu

H1 Headings

1 :
  1. Funk it up! Musiker med fötterna kvar på jorden

H2 Headings

11 :
  1. Besök hos gitarrbyggare
  2. Skriva ny musik
  3. Ny förstärkare för ännu bättre ljud
  4. En fullspäckad dag!
  5. Klä sig snyggt på scenen
  6. En tränande musiker
  7. Få inspiration till låtskriveri
  8. Ett musikaliskt geni
  9. Få råd om förmögenheter
  10. Kroppen i musik och böcker
  11. Posts navigation

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

28:
  1. Funkbone Funk it up! Musiker med fötterna kvar på jorden
    https://funkbone.nu/
  2. Funkbone De bästa just nu!
    https://funkbone.nu/de-basta-just-nu/
  3. Funkbone Jag
    https://funkbone.nu/om-mig/
  4. Funkbone Stillsamhet är bra som omväxling
    https://funkbone.nu/stillsamhet-ar-bra-som-omvaxling/
  5. Funkbone The oldies but goodies!
    https://funkbone.nu/the-oldie-but-goodies/
  6. https://funkbone.nu/author/
    https://funkbone.nu/author/
  7. Funkbone August 30, 2020
    https://funkbone.nu/besok-hos-gitarrbyggare/
  8. Funkbone Besök hos gitarrbyggare
    https://funkbone.nu/besok-hos-gitarrbyggare/
  9. Funkbone May 22, 2020
    https://funkbone.nu/skriva-ny-musik/
  10. Funkbone Skriva ny musik
    https://funkbone.nu/skriva-ny-musik/
  11. Funkbone February 9, 2020
    https://funkbone.nu/ny-forstarkare-for-annu-battre-ljud/
  12. Funkbone Ny förstärkare för ännu bättre ljud
    https://funkbone.nu/ny-forstarkare-for-annu-battre-ljud/
  13. Funkbone Jag
    https://funkbone.nu/author/copypanthers/
  14. Funkbone December 21, 2019January 22, 2020
    https://funkbone.nu/en-fullspackad-dag/
  15. Funkbone En fullspäckad dag!
    https://funkbone.nu/en-fullspackad-dag/
  16. Funkbone September 6, 2019
    https://funkbone.nu/kla-sig-snyggt-pa-scenen/
  17. Funkbone Klä sig snyggt på scenen
    https://funkbone.nu/kla-sig-snyggt-pa-scenen/
  18. Funkbone August 11, 2019August 26, 2019
    https://funkbone.nu/en-underbar-gitarr/
  19. Funkbone En tränande musiker
    https://funkbone.nu/en-underbar-gitarr/
  20. Funkbone August 8, 2019
    https://funkbone.nu/fa-inspiration-till-latskriveri/
  21. Funkbone Få inspiration till låtskriveri
    https://funkbone.nu/fa-inspiration-till-latskriveri/
  22. Funkbone June 26, 2019
    https://funkbone.nu/ett-musikaliskt-geni/
  23. Funkbone Ett musikaliskt geni
    https://funkbone.nu/ett-musikaliskt-geni/
  24. Funkbone June 3, 2019
    https://funkbone.nu/fa-rad-om-formogenheter/
  25. Funkbone Få råd om förmögenheter
    https://funkbone.nu/fa-rad-om-formogenheter/
  26. Funkbone May 17, 2019
    https://funkbone.nu/kroppen-i-musik-och-bocker/
  27. Funkbone Kroppen i musik och böcker
    https://funkbone.nu/kroppen-i-musik-och-bocker/
  28. Funkbone Older posts
    https://funkbone.nu/page/2/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Funkbone.nu

vadskulleltnuolikavad mankanskeavskriva en ltfr attspelautangralivegitarrmusikerhittakommerfinnskpaettett parellerharjag rvilkentycker jagdrngonntetkompisarfrntyckerphaeftersedanmngadet ratt jagltarskakndroftainspirationknneralltidatt skrivaom kroppenmycketdfrstrkarespnnandepengarutskrivagickvilljuatt detbstaliteaugustockstilljust numusikfickblirgrp ntetbaratajustkanngotjag harom jagkroppenoch0vethurjag skadenjag villoch jagman villsom mandelatt hamanfsom jag1som dethanatt gramentill attnytycker omsomeftersommnniskorjaglivetvenmittvarabradetnr jagnrsemedmigsignerjag skulleny musikattparomdagvarfrjag fickinteblibehverminnyajag och

Longtail Keyword Density for Funkbone.nu

KeywordsOccurences
skriva en lt3
fr att10
nr jag6
jag har6
att jag6
som jag5
som man4
om jag4
att ha4
det r4
just nu4
att det4
och jag3
tycker om3
vad man3
jag skulle3
att skriva3
att gra3
tycker jag3
jag vill3
ett par3
jag och3
jag r3
man vill3
jag fick3
p ntet3
ny musik3
till att3
jag ska3
om det3
om kroppen3
jag81
att57
och49
det39
om35
som28
p27
fr24
r23
man22
har21
inte17
till15
s15
med14
min12
den12
musik12
nr12
mig10
ska9
ett9
men8
ny8
ut8
ngot8
sig8
ven7
vill7
kan7
tycker7
bra6
frn6
kanske6
d6
nu6
av6
lite6
kroppen6
lt6
ha6
ocks6
06
gra6
olika5
blir5
kpa5
skriva5
musiker5
vad5
del5
vilken5
hur5
eller5
han5
skulle5
kommer5
dr4
pengar4
ofta4
vara4
inspiration4
ltar4
mycket4
knd4
mnga4
ta4
f4
just4
se4
14
efter4
sedan4
utan4
gitarr3
vet3
fick3
gick3
ju3
ngon3
var3
par3
august3
bsta3
livet3
dag3
gr3
eftersom3
ner3
behver3
nya3
live3
ntet3
frstrkare3
knner3
mnniskor3
spnnande3
bli3
hitta3
mitt3
bara3
finns3
kompisar3
spela3
alltid3

Who hosts Funkbone.nu?

Funkbone.nu Hosting Provider Information

Hosted IP Address:159.253.219.86
Hosted Hostname:159.253.219.86
Service Provider:Availo Networks AB
Hosted Country:SwedenSE
Location Latitude:59.3247
Location Longitude:18.056
Webserver Software:Apache

Is "Availo Networks AB" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
Availo Networks AB
0.0117%

HTTP Header Analysis for Funkbone.nu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Oct 2020 01:23:54 GMT
Server: Apache
Link:; rel="https://api.w.org/"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 10294
Content-Type: text/html; charset=UTF-8

Funkbone.nu Domain Nameserver Information

HostIP AddressCountry
ns6.binero.se 185.42.137.126
ns5.binero.se 194.58.193.124
ns4.binero.se 185.42.137.108
ns7.binero.se 195.74.39.30
ns3.binero.se 194.58.193.60


Need to find out who hosts Funkbone.nu?


Domain Registration (WhoIs) information for Funkbone.nu

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: funkbone.nu
holder: (not shown)
admin-c: (not shown)
tech-c: (not shown)
billing-c: (not shown)
created: 2013-01-03
modified: 2019-12-26
expires: 2021-01-03
nserver: ns3.binero.se
nserver: ns4.binero.se
nserver: ns5.binero.se
nserver: ns6.binero.se
nserver: ns7.binero.se
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Loopia Group AB

Websites with Similar Names

Funkbaixada.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Funkbasis.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Funkbasis.de
Funkbasis.de - Forenübersicht
Funkbit.no
Funkbit
Funkblast.site
Build a Free Website - Website Builder
Funkboerse.de
www.funkboerse.de
Funkbolashow.com
Radio Funk Bola
Funkbomb.com
Error 503: Service Unavailable

Recently Updated Websites

Atmotech.co.uk 2 seconds ago.Smartlightsystems.com 3 seconds ago.Dumanur.ru 3 seconds ago.Scriptcure.com 4 seconds ago.Plunderbust.com 4 seconds ago.Software-focus.com 5 seconds ago.Silkroaddiary.com 5 seconds ago.Chrystus.com.pl 5 seconds ago.Hcw922.com 6 seconds ago.Wcg.com.sg 6 seconds ago.Zikne.com 7 seconds ago.Tichtac.org 7 seconds ago.Momsplanner.ru 7 seconds ago.Kompozitor.su 7 seconds ago.Sanfranciscoflowermart.com 8 seconds ago.Qiqi.pro 8 seconds ago.Matsumoto-eye.com 9 seconds ago.Pennumberone.co.kr 9 seconds ago.Zamms.in 9 seconds ago.Tabak38.ru 9 seconds ago.Prepie.jp 10 seconds ago.Mybierstube.com 10 seconds ago.Repower.jp 10 seconds ago.Sea-hotel.co.il 10 seconds ago.Sjlscm.co.jp 11 seconds ago.Mates.net 11 seconds ago.Hotelgurjas.com 11 seconds ago.Beauteindienne.com 11 seconds ago.Werbeagentur.org 11 seconds ago.Linked-associate.com 12 seconds ago.