Domain summary

Last updated
2021-03-23
Domain label
garmin
Domain extension
co.in
Domain registered:
2005-07-03
Domain updated:
2021-03-23
Global Traffic Rank
445,258
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$9,720
Estimated daily income
$27
Estimated monthly income
$821

Frequently Asked Questions (FAQ)

Q: When was Garmin.co.in registered?
A: Garmin.co.in was registered 16 years, 2 months, 2 weeks, 1 day, 6 hours, 50 minutes, 1 second ago on Sunday, July 3, 2005.
Q: When was the WHOIS for Garmin.co.in last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 5 days, 6 hours, 50 minutes, 1 second ago on Tuesday, March 23, 2021.
Q: What are Garmin.co.in's nameservers?
A: DNS for Garmin.co.in is provided by the following nameservers:
  • ns.garmin.com
  • ns2.garmin.com
Q: Who is the registrar for the Garmin.co.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Garmin.co.in?
A: Garmin.co.in ranks 445,258 globally on Alexa. Garmin.co.in has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Garmin.co.in each day?
A: Garmin.co.in receives approximately 2,998 visitors and 8,994 page impressions per day.
Q: What IP address does Garmin.co.in resolve to?
A: Garmin.co.in resolves to the IPv4 address 185.132.79.79.
Q: In what country are Garmin.co.in servers located in?
A: Garmin.co.in has servers located in the United States.
Q: What webserver software does Garmin.co.in use?
A: Garmin.co.in is powered by CloudFlare webserver.
Q: Who hosts Garmin.co.in?
A: Garmin.co.in is hosted by GARMIN-ASN-1 in United States.
Q: How much is Garmin.co.in worth?
A: Garmin.co.in has an estimated worth of $9,720. An average daily income of approximately $27, which is roughly $821 per month.

Garmin.co.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Garmin.co.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Garmin.co.in

H1 Headings

0 :

H2 Headings

17 :
  1. Lily Smartwatch
  2. Venu Sq
  3. Forerunner 745
  4. Garmin Solar
  5. fēnix 6 Series
  6. NEW ARRIVALS
  7. Venu Sq
  8. Lily
  9. vívoactive 3 Element
  10. Forerunner 745
  11. GPSMAP 66sr
  12. GPSMAP 65s
  13. fenix 6 Pro Solar
  14. Instinct Solar
  15. Instinct Solar – Camo Edition
  16. Events & Related links
  17. Latest News

H3 Headings

11 :
  1. Light Up From The Inside Out
  2. GPS Smartwatch
  3. Advanced GPS running and triathlon smartwatch
  4. Do What You Love, Longer
  5. Do What You Love, Longer
  6. Give your health a fact check.
  7. Virtual Run
  8. Wearables Series
  9. NEWS
  10. NEWS
  11. NEWS

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

17 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-6211596-13

Links - Internal

79:

Links - Internal (nofollow)

0:

Links - Outbound

57:

Links - Outbound (nofollow)

0:

Keyword Cloud for Garmin.co.in

30knockoutnav categorymethod of osans tcnoto sansupdate golfcode 13opensearchinputindoorlearn moreminwidth1200pxgflistitemknotfocuswhetherhavecustomeventsearchinputvaluegflistitemiconnav categoriesnavlink shouldfirsttraining30knockout 28robotonoto sansthisargshow the componentsans krpromptsansserifmicrosoftlenjpnoto sans1remrunnavlink should closescnotodocumentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocusstartdaterunning0 0nextcolumngflistif documentactiveelementparentelementewhich ifhealthparamsactivityif typeofexpressenvironmentlinksminwidth1200pxgflistitem gflistkeycategoriesthrowthisclasslistremovejsmegamenuitemactive documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindexkeyboard navigationelementvvoactive 3 elementendvar codenewsgetcartproductcountcurrentdiscontinuedmapscheckifupkvaluedocumentactiveelementparentelementfunction if typeofallcyclingwearablesfalseappshandlesigninoutlinkssansshowtruegarmin expressjpnoto sans krpromptrobotojpsansserifgflistitemsans scnotonewjpnoto sans krpromptsansserifmicrosoft28noto sans tcnoto28robotonoto sans1undefinedcodeif codekrpromptroboto condensedrobotosansserifmicrosoftheadingcategory if documentactiveelementkeeptspanwhitespacepreshp0fill000productsttspanwhitespacepreshp0fill000garminresult30knockout 28noto sansstringnavenddatedocumentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindex2rem 0screen and minwidth1200pxgflistitemmusicsans krpromptrobotoewhichviewif code 13mega menushould closesonareventopen28robotonotoclosesans tcnotosolarsans jpnoto sanssolidnowparamlilyscnoto sanskeyboardconnectgps smartwatch2remsans scsansserifgflistitemdisplay3scnoto sans jpnotomenuelsetspanwhitespacepreshp0fill000appsdiscoverentervalue28noto sansscsansserifgflistitemvar3 elementinternaloutdoorkrpromptsansserifmicrosofttcnoto sans scnotoshouldclosemobilemenudatereturncategory ifgolflearngflist gflistitemekeycode ewhich ifthisclasslistremovejsmegamenuitemactive documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocuscondensedrobotosansserifmediakrpromptrobotovvoactive 3currentindex 0sans jpsansserifgflistitemvar code ekeycodemobile0 000closesearchinputnav category ifmaphandheldsmapsdocumentactiveelementargumentsans scnoto sanssans krsansserifgflistitemtcnotosmartwatchmegafunction41pxcondensedrobotosansserifmicrosoftpressingdocumentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindex 0if documentactiveelementyournavlinkgetinternal methodcurrentindexnextvvoactiveitsdocumentactiveelementparentelement elementclosemegamenudropdowncondensedrobotosansserifmedia screen30knockout 28robotonotoyour healthfunction ifkrsansserifgflistitemcurrentindex 1localeepreventdefaultscreen000eventsmore28notoepreventdefault pressingjpnotoelementsif documentactiveelementparentelement elementpkmenu and focussans krpromptroboto condensedrobotosansserifmicrosoftcookieekeycode ekeycodeupdateheaderclasslistremoveghheadernavactivecomponentproductscountekeycodemethoditemsmenuiconcallingresult of callingsans tcsansserifgflistitemcode ekeycode1rem 1remtspanwhitespacepreshp0fill000appsdiscover tspanwhitespacepreshp0fill000garminmap updatecode ekeycode ekeycodewhile30knockout 28notogflistitemyoutabmap update golfekeycode ekeycode ewhichthisclasslistremovejsmegamenuitemactivenulltechnologyif keysmapcodecloseutilitydropdowns0callback2rem 0 000ampletotypeoftcsansserifgflistitemhandlekeysmapcodenavigationsans jpnototcnoto sanskey should2garminekeycode ewhichcategorygpsconst

Longtail Keyword Density for Garmin.co.in

KeywordsOccurences
sans tcnoto sans24
sans scnoto sans24
scnoto sans jpnoto24
sans jpnoto sans24
tcnoto sans scnoto24
30knockout 28robotonoto sans20
jpnoto sans krpromptsans-serifmicrosoft18
if documentactiveelementparentelement element7
sans krpromptroboto condensedrobotosans-serifmicrosoft6
screen and min-width1200pxgflistitem6
jpnoto sans krpromptroboto6
30knockout 28noto sans6
28noto sans tcnoto6
nav category if5
map update golf4
result of calling4
var code ekeycode4
code ekeycode ekeycode4
ekeycode ekeycode ewhich4
menu and focus4
navlink should close3
vvoactive 3 element3
show the component3
category if documentactiveelement3
ekeycode ewhich if3
-2rem 0 0003
documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindex 03
thisclasslistremovejsmega-menu-item--active documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindex3
if code 133
method of o3
function if typeof3
sans tcnoto24
tcnoto sans24
sans scnoto24
scnoto sans24
sans jpnoto24
jpnoto sans24
28robotonoto sans20
30knockout 28robotonoto20
gflist gflistitem18
sans krpromptsans-serifmicrosoft18
mega menu7
nav category7
if typeof7
documentactiveelementparentelement element7
if documentactiveelementparentelement7
krpromptroboto condensedrobotosans-serifmicrosoft6
30knockout 28noto6
sans krpromptroboto6
28noto sans6
category if5
map update5
if keysmapcode5
currentindex 05
nav categories4
key should4
epreventdefault pressing4
should close4
sans tcsans-serifgflistitem4
sans krsans-serifgflistitem4
ekeycode ewhich4
ekeycode ekeycode4
code ekeycode4
var code4
currentindex 14
function if4
internal method4
min-width1200pxgflistitem gflist4
sans scsans-serifgflistitem4
sans jpsans-serifgflistitem4
update golf4
1rem 1rem3
vvoactive 33
your health3
3 element3
learn more3
gps smartwatch3
ewhich if3
if documentactiveelement3
navlink should3
documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus currentindex3
thisclasslistremovejsmega-menu-item--active documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus3
code 133
if code3
keyboard navigation3
garmin express3
tspanwhite-spacepreshp0fill000appsdiscover tspanwhite-spacepreshp0fill000garmin3
condensedrobotosans-serifmedia screen3
0 0003
-2rem 03
0 03
sans148
screen63
if54
var40
033
30knockout31
function31
gflist28
tcnoto24
scnoto24
jpnoto24
28robotonoto20
krpromptsans-serifmicrosoft18
gflistitem18
element17
115
garmin13
key13
should12
new12
nav11
else10
k10
pressing10
smartwatch10
currentindex10
return10
amp10
cookie9
let9
code9
1rem9
ekeycode8
epreventdefault8
solid8
category8
gps8
undefined8
o8
startdate7
typeof7
enddate7
focus7
mega7
menu7
your7
documentactiveelementparentelement7
map7
close6
method6
keysmapcode6
min-width1200pxgflistitem6
all6
golf6
condensedrobotosans-serifmicrosoft6
event6
locale6
solar6
28noto6
you6
false6
view6
more6
thisarg6
krpromptroboto6
health6
value5
next5
check5
argument5
null5
update5
t5
component5
date5
now5
closeutilitydropdowns5
kvalue5
not5
closemegamenudropdown5
navigation5
wearables5
jpsans-serifgflistitem4
itemsmenuicon4
categories4
ewhich4
keep4
24
current4
getcartproductcount4
handlesigninoutlinks4
running4
first4
nextcolumn4
display4
krsans-serifgflistitem4
tspanwhite-spacepreshp0fill000products4
its4
const4
up4
string4
tcsans-serifgflistitem4
express4
get4
internal4
calling4
34
len4
result4
music4
news4
tab4
training4
scsans-serifgflistitem4
keyboard4
connect4
show3
param3
-2rem3
documentactiveelement3
handle3
whether3
environment3
elements3
0003
learn3
end3
run3
vvoactive3
lily3
productscount3
1px3
navlink3
indoor3
throw3
maps3
apps3
sonar3
handhelds3
cycling3
technology3
43
tspanwhite-spacepreshp0fill000garmin3
tspanwhite-spacepreshp0fill000appsdiscover3
discontinuedmaps3
outdoor3
activity3
links3
condensedrobotosans-serifmedia3
callback3
while3
documentactiveelementclosestliqueryselectorghnavcategoriesitemslinkfocus3
mobile3
thisclasslistremovejsmega-menu-item--active3
heading3
enter3
headerclasslistremoveghheadernav--active3
searchinputvalue3
closemobilemenu3
have3
pk3
open3
closesearchinput3
opensearchinput3
events3
params3
customevent3
true3
gflistitemicon3

Who hosts Garmin.co.in?

Garmin.co.in Hosting Provider Information

Hosted IP Address:185.132.79.79
Hosted Hostname:edgeredirect.garmin.com
Service Provider:GARMIN-ASN-1
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "GARMIN-ASN-1" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
GARMIN-ASN-1
0.0001%

HTTP Header Analysis for Garmin.co.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Mar 2021 07:52:55 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Strict-Transport-Security: max-age=31536000;includeSubdomains
Expires: Tue, 23 Mar 2021 11:52:55 GMT
Last-Modified: Tue, 23 Mar 2021 01:38:17 GMT
Pragma: no-cache
Vary: Accept-Encoding
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
CF-Cache-Status: HIT
Age: 22478
Cache-Control: public, max-age=14400
cf-request-id: 08ffab9ccb0000ce1b09bae000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 634615414985ce1b-LHR
Content-Encoding: gzip

Garmin.co.in Domain Nameserver Information

HostIP AddressCountry
ns.garmin.com 122.248.184.247Australia Australia
ns2.garmin.com 122.248.184.247Australia Australia


Need to find out who hosts Garmin.co.in?


Domain Registration (WhoIs) information for Garmin.co.in

Websites with Similar Names

Recently Updated Websites

Justride.live (1 second ago.)Pils.in (2 seconds ago.)Magicofabba.net (4 seconds ago.)Gcbsecurities.info (5 seconds ago.)Iownmyevidence.com (7 seconds ago.)Denverenergyawareness.org (7 seconds ago.)Tarsuscagdas.com (9 seconds ago.)Ro-webdesign.info (9 seconds ago.)Offerwsl.com (10 seconds ago.)Callinglight.com (11 seconds ago.)Chakimamicheau.com (12 seconds ago.)Maxflixtv.com (12 seconds ago.)Patrickmasonartist.com (13 seconds ago.)Womenor.com (13 seconds ago.)Ab0.vip (15 seconds ago.)Smarthomealive.com (17 seconds ago.)Sevendotproductions.com (20 seconds ago.)Fundzeasy.com (20 seconds ago.)Creatormundi.com (22 seconds ago.)Napowrimo.net (22 seconds ago.)Zehnsolutions.com (23 seconds ago.)Sandiegohose.com (23 seconds ago.)Moffett-towers-2-club.info (25 seconds ago.)Babyyful.com (25 seconds ago.)Jazzmusiccombo.com (27 seconds ago.)Kffc.org (29 seconds ago.)Leecompanyinc.com (29 seconds ago.)Mlkyouthrally.org (30 seconds ago.)Growpractice.net (30 seconds ago.)Demothink.com (31 seconds ago.)

Recently Searched Keywords

1border-stylesolidborder-colorrgba255 (1 second ago.)pas un (1 second ago.)healthyway2u (1 second ago.)instagram post 18164141683039683 (2 seconds ago.)mobile phone deals (3 seconds ago.)the impact of covid-19 on pregnancy outcomes: a systematic review and meta-analysis (3 seconds ago.)parentorganization name (3 seconds ago.)85cc 85cc (4 seconds ago.)the shop (5 seconds ago.)cancelled you (5 seconds ago.)nexus dialogue programme (5 seconds ago.)telephone 1-801-233-6662 (5 seconds ago.)panier cafeacute (6 seconds ago.)showfeaturing cathy (6 seconds ago.)wnba books (7 seconds ago.)2368 23752306 237923792366 (7 seconds ago.)赚钱手游 (8 seconds ago.)panchang (8 seconds ago.)gewalt (8 seconds ago.)ints (9 seconds ago.)amp (9 seconds ago.)ounces of gold (10 seconds ago.)570 (11 seconds ago.)オーストラリア (12 seconds ago.)ooitcy (13 seconds ago.)kuchnia nastolatka (13 seconds ago.)forgetfulness (14 seconds ago.)music award (14 seconds ago.)ohrschmuck titan blau (14 seconds ago.)functionurl id if (15 seconds ago.)