Gatrialattorney.com  |  Georgia Trial Lawyer - Joel Williams
Joel Williams is a Georgia Trial Lawyer dedicated to serving his clients and fighting for their legal rights. Call him today at 404.389.1035.


Category:
Unknown
Registration Date:
2014-10-02
Domain Registrar:
GODADDY.COM, LLC
Service Provider:
TOT Public Company Limited  United States
Safety:
Low trust score
Late Updated:
5 months 2 weeks ago

Gatrialattorney.com Website Information

Gatrialattorney.com was registered 3 years 1 month ago. It is a domain with an .com extension and is hosted by TOT Public Company Limited.
It has an estimated worth of $ 8.95 and has an average daily income of approximately $ 0.15.
Gatrialattorney.com is SAFE to browse as we did not find any active threats.

Website Ranks & Scores for Gatrialattorney.com

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
PageSpeed Google PageSpeed:57%
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Social Engagement for Gatrialattorney.com

Facebook Shared:204
Facebook Like Count:0
Facebook Comment Count:0
Twitter Tweets:0
LinkedIn Shares:0
Google Plus Shares:0


Gatrialattorney.com Traffic Report

Daily Unique Visitors:Not Applicable
Daily Pageviews:Not Applicable

Gatrialattorney.com Estimated Valuation

Income Per Day:$ 0.15
Estimated Worth:$ 8.95

Search Engine Indexes for Gatrialattorney.com

Google Indexed Pages:View Google pages
Yahoo Indexed Pages:View Yahoo pages
Bing Indexed Pages:View Bing pages
History:View WayBackMachine history

Search Engine Backlinks for Gatrialattorney.com

Google Backlinks:0
Bing Backlinks:0
Alexa BackLinks:0

Safety Information for Gatrialattorney.com

Google Safe Browsing:No Risk Issues
Siteadvisor Rating:Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Domain Information for Gatrialattorney.com

Domain Registrar: GODADDY.COM, LLC
Registration Date:2014-10-02  3 years 1 month 2 weeks ago
Last Modified:2017-03-29  7 months 2 weeks 6 days ago
Expiration Date:2024-10-02  6 years 10 months 1 week from now

Similarly Ranked Websites to Gatrialattorney.com

2 YouTube

3 Facebook - Inicia sesión o regístrate

Crea una cuenta o inicia sesión en Facebook. Conéctate con amigos, familiares y otras personas que conozcas. Comparte fotos y videos, envía mensajes y...

4

5 Yahoo

News, email and search are just the beginning. Discover more every day. Find your yodel.

6 Wikipedia

Whois information for gatrialattorney.com

Full Whois Lookup for Gatrialattorney.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Gatrialattorney.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: GATRIALATTORNEY.COM
Registry Domain ID: 1878615952_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-06-14T20:12:46Z
Creation Date: 2014-10-02T15:00:03Z
Registry Expiry Date: 2024-10-02T15:00:03Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.US76.SITEGROUND.US
Name Server: NS2.US76.SITEGROUND.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-17T20:03:10Z

Who hosts Gatrialattorney.com?

Gatrialattorney.com is hosted by TOT Public Company Limited in California, San Francisco, United States, 94107.
Gatrialattorney.com has an IP Address of 104.31.68.175 and a hostname of 104.31.68.175 and runs cloudflare-nginx web server.



Gatrialattorney.com Web Server Information

Hosted IP Address:104.31.68.175
Hosted Hostname:104.31.68.175
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.7697
Location Longitude:-122.3933
Webserver Software:cloudflare-nginx
Google Map of 50,12

Websites Hosted on Same IP (i.e. 104.31.68.175)

SOTTOCOPERTA.NET: il portale di Viaggi, Enogastronomia e...
- sottocoperta.net

SOTTOCOPERTA.NET: il portale di Viaggi, Enogastronomia e Creativita'. ©2001-2014. Ricette, itinerari e diari di viaggio, hotel, agriturismi, campeggi e BB, musei, eventi e...

  178,367   $ 52,200.00

???? ???????? ? ?????????
- extreme-voyage.ru

???? ?????????????: ?????, ????? ? ?????? ?????????, ??????????? ?????????????, ??????? ?????????? ? ???????????? ??? ?????, ???????, ?????????, ???????????? ????????.

  921,608   $ 960.00

Oakview Assisted Living Facility
- oakviewresidentialcare.com

  8,707,217   $ 8.95

DescargasFull.ORG -
- descargasfull.org

  Not Applicable   $ 8.95

Apache HTTP Server Test Page powered by CentOS
- qualityinteriorstolove.xyz

  Not Applicable   $ 8.95

HTTP Header Analysis for Gatrialattorney.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 25 Apr 2017 01:10:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.4.45
Link:; rel="https://api.w.org/", ; rel=shortlink
Server: cloudflare-nginx
CF-RAY: 354d6bfa6f300cd7-LHR
Content-Encoding: gzip


Need to find out who hosts Gatrialattorney.com?

Gatrialattorney.com Free SEO Report

Page Title of gatrialattorney.com

Georgia Trial Lawyer - Joel Williams

Meta Description of gatrialattorney.com

Joel Williams is a Georgia Trial Lawyer dedicated to serving his clients and fighting for their legal rights. Call him today at 404.389.1035.

Meta Tags of gatrialattorney.com

No tags found

Website Inpage Analysis for Gatrialattorney.com

H1 Headings:0
H2 Headings:12
 Automobile Accidents
 Trip & Falls
 Tractor-Trailer Accidents
AWARDS & ACCOLADES
AWARDS & ACCOLADES
OUR PERSONAL INJURY VICTORIES
Call for a FREE Consultation 404.389.1035 Free Consultation
Welcome to Joel Williams Law,LLCYour Kennesaw GeorgiaTrial Attorneys
Welcome to Joel Williams Law,LLCYour Kennesaw GeorgiaTrial Attorneys
HAVE A QUESTION?
KENNESAW PERSONAL INJURY ATTORNEY
PERSONAL INJURY LAWYERS
H3 Headings:6
404.389.1035
404.389.1035
Personal Injury is Complicated. Let Us Help with Your Case!
404.389.1035
Personal Injury is Complicated. Let Us Help with Your Case!
Joel Williams is an Award Winning, Tractor-Trailer, Personal Injury Lawyer Located Just North of Atlanta Ga.
H4 Headings:5
 Automobile Accidents
 Trip & Falls
 Tractor-Trailer Accidents
Title
WE’RE HERE TO
H5 Headings:0
H6 Headings:0
Total IFRAMEs:2
Total Images:30
Google Adsense:Not Applicable
Google Analytics:UA-104484436-1

Keyword Cloud for Gatrialattorney.com

find out moreuscar accidenthtmldiv documentgetelementbyidrspluginsettingsinlinecssyourautomobileout moreout4043891035 freedocumentcreateelementdiv htmldivinnerhtml htmldivcssimportantelse var htmldivgeorgiakennesaw personallawyersfind outfontfamilycontactyou needdisplayyouhtmldivcsspremises liability injuriesfindhtmldivmedicalinjuredifhtmldiv htmldivinnerhtmlwilliams lawvar htmldivcssdocumentcreateelementdivwilliamssomeoneautomobile collisionsinvolvingneedhtmldivinnerhtml htmldivinnerhtmlwrecksansserif importantfaultwrecksfirmifvalueelseserious1documentcreateelementdiv htmldivinnerhtmlfreecaseifhtmldivattorneyscarjoel williams lawjoel williamsliability injurieshtmldivcss else varnonepersonalarialcasesplaintiffaccident injuriestrial4043891035 free consultationkennesawdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0var htmldiv documentcreateelementdivvarhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0premisesslipmeetnegligent securityliabilityyour casesansseriflawdomalpracticejoelpremises liabilityvar htmldiv documentgetelementbyidrspluginsettingsinlinecsshtmldiv documentcreateelementdiv htmldivinnerhtmlatlantahtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0consultationcar accident injurieslegalmoreaccidentsvar htmldivrecoverydocumentgetelementbyidrspluginsettingsinlinecsshtmldivinnerhtmlifhtmldiv htmldivinnerhtml htmldivinnerhtmlhtmldivinnerhtml htmldivinnerhtml htmldivcsseverypersonal injuryhtmldivinnerhtml htmldivcss elseourinjurieshelphtmldivinnerhtml htmldivcsskennesaw personal injuryattorneyaccidenthavefree consultationcar accidentsbig0else vartherefontfamily ariallearnhtmldiv documentcreateelementdivcollisionslearn morenegligenttractortrailerhtmldivcss elsewesecurityinjury

Longtail Keyword Density for Gatrialattorney.com

KeywordsOccurences
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
documentcreateelementdiv htmldivinnerhtml htmldivcss3
htmldiv documentcreateelementdiv htmldivinnerhtml3
find out more3
car accident injuries3
joel williams law3
premises liability injuries3
var htmldiv documentcreateelementdiv3
else var htmldiv3
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
kennesaw personal injury3
ifhtmldiv htmldivinnerhtml htmldivinnerhtml3
htmldivinnerhtml htmldivinnerhtml htmldivcss3
htmldivcss else var3
htmldivinnerhtml htmldivcss else3
4043891035 free consultation3
personal injury13
joel williams8
free consultation7
htmldivinnerhtml htmldivcss6
premises liability6
var htmldiv6
your case4
car accident4
accident injuries4
find out3
out more3
williams law3
sans-serif important3
learn more3
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
you need3
liability injuries3
font-family arial3
htmldivcss else3
negligent security3
kennesaw personal3
automobile collisions3
car accidents3
4043891035 free3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
var htmldivcss3
htmldiv documentcreateelementdiv3
else var3
htmldivinnerhtml htmldivinnerhtml3
ifhtmldiv htmldivinnerhtml3
documentcreateelementdiv htmldivinnerhtml3
injuries17
injury15
personal15
case14
you14
var10
our10
your10
htmldivinnerhtml9
htmldivcss9
car9
kennesaw8
cases8
liability8
joel8
williams8
important7
consultation7
free7
if7
premises7
more7
htmldiv6
fault6
georgia6
accidents6
accident6
else6
malpractice6
wrecks5
lawyers5
we5
attorneys5
medical5
help5
04
out4
law4
firm4
injured4
there4
plaintiff4
need4
security4
negligent4
attorney4
wreck4
none4
learn3
involving3
13
us3
every3
value3
do3
someone3
contact3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
trial3
atlanta3
documentgetelementbyidrs-plugin-settings-inline-css3
ifhtmldiv3
display3
tractor-trailer3
automobile3
slip3
legal3
documentcreateelementdiv3
collisions3
font-family3
arial3
sans-serif3
big3
find3
meet3
recovery3
serious3
have3

Gatrialattorney.com Page Resources Breakdown

Gatrialattorney.com Homepage Links Analysis

Alexa Traffic Rank for Gatrialattorney.com

Alexa Search Engine Traffic for Gatrialattorney.com

What are the nameservers for gatrialattorney.com?

Gatrialattorney.com Domain Nameserver Information

HostIP AddressCountry
dale.ns.cloudflare.com 173.245.59.95United States United States
dora.ns.cloudflare.com 173.245.58.108United States United States

Gatrialattorney.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
gatrialattorney.comA296IP: 104.31.69.175
gatrialattorney.comA296IP: 104.31.68.175
gatrialattorney.comNS86400Target: dale.ns.cloudflare.com
gatrialattorney.comNS86400Target: dora.ns.cloudflare.com
gatrialattorney.comSOA3600MNAME: dale.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2024243959
Refresh: 10000
Retry: 2400
Expire: 604800
gatrialattorney.comMX300Target: gatrialattorney-com.mail.protection.outlook.com
gatrialattorney.comTXT300TXT: MS=ms53586478
gatrialattorney.comTXT300TXT: v=spf1
include:spf.protection.outlook.com -all
gatrialattorney.comTXT300TXT:
google-site-verification=80v63UlE2PO2JV3
G7G5oq1-pNdG62Z6d3CGG61V2bdA
gatrialattorney.comAAAA296IPV6: 2400:cb00:2048:1::681f:45af
gatrialattorney.comAAAA296IPV6: 2400:cb00:2048:1::681f:44af

What are the alternatives to gatrialattorney.com?

We know of 0 alternatives to gatrialattorney.com.

You can suggest alternatives to gatrialattorney.com if you know of any.



Gatrialattorney.com Alternatives Suggest an alternative

We don't know of any alternatives to this website.

If you know of any, please suggesting one.

{**}