ENGIE Italia | Luce, gas, efficienza energetica e servizi

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: Unknown
Estimated Worth: $1,440

Luce, gas, efficienza energetica e servizi per casa, imprese e pubblica amministrazione. ENGIE Italia il n.1 per i servizi energetici al mondo.



Domain summary

Last updated
2020-10-21
Domain label
gdfsuez
Domain extension
it
Domain registered:
0000-00-00
Domain updated:
0000-00-00
Domain expires:
2015-08-06
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Rank summary

How is gdfsuez.it ranked relative to other sites:

Percentage of visits to gdfsuez.it from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Gdfsuez.it registered?
A: Gdfsuez.it was registered 2021 years, 4 months, 2 weeks, 3 days, 4 hours, 30 minutes, 46 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Gdfsuez.it last updated?
A: The WHOIS entry was last updated 2021 years, 4 months, 2 weeks, 3 days, 4 hours, 30 minutes, 46 seconds ago on Monday, November 30, -0001.
Q: What are Gdfsuez.it's nameservers?
A: DNS for Gdfsuez.it is provided by the following nameservers:
  • c.ns.mailclub.com
  • b.ns.mailclub.eu
  • a.ns.mailclub.fr
Q: Who is the registrar for the Gdfsuez.it domain?
A: The domain has been registered at IT-Nic.
Q: What is the traffic rank for Gdfsuez.it?
A: Gdfsuez.it has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Gdfsuez.it each day?
A: Gdfsuez.it receives approximately 726 visitors and 1,954 page impressions per day.
Q: What IP address does Gdfsuez.it resolve to?
A: Gdfsuez.it resolves to the IPv4 address 151.1.253.200.
Q: In what country are Gdfsuez.it servers located in?
A: Gdfsuez.it has servers located in the Italy.
Q: What webserver software does Gdfsuez.it use?
A: Gdfsuez.it is powered by Apache-Coyote/1.1 webserver.
Q: Who hosts Gdfsuez.it?
A: Gdfsuez.it is hosted by ITnet S.r.l. in Liguria, Genova, Italy, 16151.
Q: How much is Gdfsuez.it worth?
A: Gdfsuez.it has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Gdfsuez.it Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Gdfsuez.it Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Gdfsuez.it

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 1

H3 Headings

1 :
  1. 1

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

2 :

Total Images

53 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-51638489-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Gdfsuez.it

divs ricercaresultsinnerslidetextengie italia1pxwidth 100 importantdivselseashow ricercacondomini imprese entipianeta scopri dirgba0 0chenomewindowmatchmediamaxwidth 767pxmatchesflexsegui ilvar divs ricercaresultsinnertuttiricerca next ashownext ahidergba0upnone documentgetelementbyidtwitterparstyledisplaynone documentgetelementbyidlinkedinparstyledisplay nonevideoidcolor310px 10px 10pxnostro canalesegui il nostronbspnonetxtimgswitchdocumentgetelementbyidyoutubeparstyledisplayposition fixedbottomimprese enti0 0110px 10pxricerca next ahideall 03srgba0 0 0translate3d01000if windowmatchmediamaxwidth 767pxmatchescasavarmediadisplaydocumentgetelementbyidlinkedinparstyledisplay noneallmaxwidthnostrifollower nbsppiminwidth 769pxrepeattransformricercafontsizeservizientinewhome slidetexttextaligndocumentgetelementbyidlinkedinparstyledisplayco2impianti4efficienzatabscontentfirstaddclassfadeinupenergiasiamorepeat scrollil pianetaeventidisplay inlineblock035ricercaresultsinner0 0 035floatleft mediacondomini impresenostraenergeticapresenzarepeat scroll 0ashow elsemedia maxwidthpubblicazioni767pxeventi comunicati stampalightboxversionedue smallheightpadding 10pxricercaresultsinner wrapimgtxtswitch1px 0pxscopri di pirelativebackground nonedivs ricercaresultsinner wrapfadeinupdisplay flexfunctione767pxmatchesbackgroundefficienza energeticanextbackground none repeatnostro impegno769pxmedia maxwidth 767pxcondominicolor fffif25pxnone documentgetelementbyidyoutubeparstyledisplay nonedelladocumentgetelementbyidfacebookparstyledisplaywhiteil nostro canaleprivacysmallscrollguardaif windowmatchmediamaxwidthtextshadow 0pxgasseguinone documentgetelementbyidlinkedinparstyledisplayleftilimpegnoarrimgeventi comunicati0px 1pxprev ahide ricercadicondisplay nonetextshadowonoidocumentreadyfunctionposition relativemenopaddingnone importantfollowerricerca prevlinkedinwebkittransform10pxpxdocumentgetelementbyidfacebookparstyledisplay none documentgetelementbyidlinkedinparstyledisplaycookiecookiecookieconsentahide ricerca nextdocumentgetelementbyidtwitterparstyledisplay nonedisplay none importantnews eventiborderboxurldocumentgetelementbyidyoutubeparstyledisplay nonefixedricerca prev ashowpi siamo8pxnone documentgetelementbyidyoutubeparstyledisplaycenterscale104nostrodivslengthinputnamesearchengineportletwarsearchengineportletinstancee3j7nomeval varlightboxversioneduelineheight0pxfloatleftnone repeat scrollnone repeatimportantricerca prev ahidetextshadow 0px 1pxelse ricercaimpresedocumentgetelementbyidlinkedinparstyledisplay none documentgetelementbyidtwitterparstyledisplaynbsp nbspdisplay block importantil nostro impegnosrcscroll 0ahide ricercafff0px rgba0 0lightboxcssdisplay nonericerca nextcomunicatidocumentgetelementbyidtwitterparstyledisplayimportant mediacomunicati stampascopri diminwidthitaliafunctionfacebooknews eventi comunicatigreen0px rgba0next ashowsport1px 0px rgba0zindexmedia minwidthfloatleft media minwidthpagerscroll 0 0important media maxwidthnewswindowmatchmediamaxwidthengiecomplianceeucookiebannerahide5pxefunctione documentgetelementbyidfacebookparstyledisplaydi piashowpianeta scopriil pianeta scopriblock importantopacitycasa condomini impreseper ilwidth 100tabscontentfirstremoveclasstabscontentfunctione documentgetelementbyidfacebookparstyledisplay nonereturnfontsize 13pxlightboxcssdisplay013pxinputnamesearchengineportletwarsearchengineportletinstancee3j7nomevalscopriper noilemaxwidth 767pxinsiemeogniblocktextalign centeril nostrotabscontentfirstaddclassfadeinup tabscontentfirstremoveclasstabscontentfalseashow else ricercawrapprev ahideprev ashowprevdocumentgetelementbyidfacebookparstyledisplay noneneicasa condominimanagementvar divsopacity 103snewhome2inlineblockpianeta40px100 importantstampaepreventdefaultvideo0 035background fffcanalemedia minwidth 769px0px 1px 0pxpaginapositionajaxdisplay blockunpersoliddocumentgetelementbyidtwitterparstyledisplay none documentgetelementbyidyoutubeparstyledisplaywidth

Longtail Keyword Density for Gdfsuez.it

KeywordsOccurences
scopri di pi6
ricerca next ahide5
display none important5
il pianeta scopri4
if windowmatchmediamax-width 767pxmatches4
media max-width 767px4
pianeta scopri di4
condomini imprese enti4
casa condomini imprese4
segui il nostro4
important media max-width4
il nostro canale4
documentgetelementbyidfacebook-parstyledisplay none documentgetelementbyidlinkedin-parstyledisplay4
ricerca prev ahide4
ricerca next ashow4
10px 10px 10px4
none repeat scroll3
background none repeat3
repeat scroll 03
var divs ricerca-results-inner3
scroll 0 03
documentgetelementbyidlinkedin-parstyledisplay none documentgetelementbyidtwitter-parstyledisplay3
text-shadow 0px -1px3
0px -1px 0px3
-1px 0px rgba03
0px rgba0 03
rgba0 0 03
0 0 0353
documentgetelementbyidtwitter-parstyledisplay none documentgetelementbyidyoutube-parstyledisplay3
media min-width 769px3
functione documentgetelementbyidfacebook-parstyledisplay none3
none documentgetelementbyidyoutube-parstyledisplay none3
none documentgetelementbyidlinkedin-parstyledisplay none3
divs ricerca-results-inner wrap3
display block important3
width 100 important3
il nostro impegno3
eventi comunicati stampa3
news eventi comunicati3
ahide ricerca next3
prev ahide ricerca3
ashow else ricerca3
ricerca prev ashow3
floatleft media min-width3
ricerca next10
il nostro9
width 1009
0 08
media min-width8
ricerca prev8
di pi7
important media7
media max-width7
scopri di6
display none6
10px 10px6
none important6
next ahide5
comunicati stampa5
position fixed5
documentgetelementbyidlinkedin-parstyledisplay none4
text-align center4
none documentgetelementbyidyoutube-parstyledisplay4
segui il4
none documentgetelementbyidlinkedin-parstyledisplay4
100 important4
if windowmatchmediamax-width4
documentgetelementbyidfacebook-parstyledisplay none4
documentgetelementbyidyoutube-parstyledisplay none4
none documentgetelementbyidtwitter-parstyledisplay4
functione documentgetelementbyidfacebook-parstyledisplay4
max-width 767px4
nostro canale4
windowmatchmediamax-width 767pxmatches4
next ashow4
ashow ricerca4
prev ahide4
per il4
casa condomini4
condomini imprese4
imprese enti4
engie italia4
efficienza energetica4
ahide ricerca4
il pianeta4
pianeta scopri4
rgba0 03
0px rgba03
follower nbsp3
0 0353
color fff3
none repeat3
text-shadow 0px3
-1px 0px3
0px -1px3
background none3
scroll 03
repeat scroll3
nbsp nbsp3
documentgetelementbyidtwitter-parstyledisplay none3
inputnamesearchengineportletwarsearchengineportletinstancee3j7nomeval var3
display flex3
all 03s3
per noi3
var divs3
divs ricerca-results-inner3
ricerca-results-inner wrap3
prev ashow3
ashow else3
else ricerca3
news eventi3
eventi comunicati3
nostro impegno3
pi siamo3
newhome slide-text3
tabs-contentfirstaddclassfadeinup tabs-contentfirstremoveclasstabs-content3
light-boxcssdisplay none3
display inline-block3
background fff3
opacity 13
font-size 13px3
light-boxversionedue small3
display block3
block important3
padding 10px3
position relative3
min-width 769px3
floatleft media3
none36
important36
di35
033
var33
nbsp31
width25
e25
il24
ricerca23
center22
display21
media20
per19
engie18
function16
pi15
10px13
113
0px12
font-size12
padding12
background11
height11
next10
max-width10
scopri10
else9
energia9
min-width9
ahide9
nostro9
position9
if8
block8
prev8
siamo8
color7
nome7
27
tutti7
le7
italia7
ashow7
pager6
fff6
che6
pianeta6
casa6
un6
video6
news6
opacity6
documentreadyfunction6
noi6
px5
comunicati5
guarda5
bottom5
z-index5
nostra5
stampa5
functione5
line-height5
fixed5
scroll5
documentgetelementbyidfacebook-parstyledisplay5
documentgetelementbyidyoutube-parstyledisplay5
con5
documentgetelementbyidlinkedin-parstyledisplay5
sport5
-webkit-transform5
energetica5
transform5
25px5
documentgetelementbyidtwitter-parstyledisplay5
fadeinup5
follower4
floatleft4
segui4
canale4
windowmatchmediamax-width4
cookiecookieconsent4
767pxmatches4
translate3d010004
border-box4
text-align4
false4
management4
nostri4
enti4
imprese4
efficienza4
condomini4
servizi4
presenza4
meno4
url4
insieme4
divslength4
epreventdefault4
767px4
src4
slide-text4
repeat3
0353
impegno3
all3
03s3
scale1043
cookie3
inputnamesearchengineportletwarsearchengineportletinstancee3j7nomeval3
pagina3
nei3
pubblicazioni3
text-shadow3
eventi3
facebook3
linkedin3
rgba03
tabs-contentfirstremoveclasstabs-content3
-1px3
wrap3
ricerca-results-inner3
divs3
return3
privacy3
inline-block3
arrimg3
tabs-contentfirstaddclassfadeinup3
13px3
videoid3
ajax3
light-boxcssdisplay3
left3
33
newhome3
della3
green3
ogni3
40px3
up3
flex3
compliance-eu-cookie-banner3
impianti3
light-boxversionedue3
small3
8px3
co23
43
solid3
white3
relative3
gas3
769px3
5px3
txtimgswitch3
imgtxtswitch3
o3

Who hosts Gdfsuez.it?

Gdfsuez.it Hosting Provider Information

Hosted IP Address:151.1.253.200
Hosted Hostname:151.1.253.200
Service Provider:ITnet S.r.l.
Hosted Country:ItalyIT
Location Latitude:44.4063
Location Longitude:8.93386
Webserver Software:Apache-Coyote/1.1

Is "ITnet S.r.l." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
ITnet S.r.l.
0.0028%

HTTP Header Analysis for Gdfsuez.it

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 21 Oct 2020 00:02:50 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache-Coyote/1.1
Cache-Control: private, no-cache, no-store, must-revalidate
Strict-Transport-Security: max-age=604800; includeSubDomains; preload
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-eval' https://js-agent.newrelic.com https://in.hotjar.com https://vars.hotjar.com https://script.hotjar.com https://static.hotjar.com https://bam.nr-data.net https://www.google.it https://www.google.com https://www.google-analytics.com https://ssl.google-analytics.com https://googleads.g.doubleclick.net https://www.googleadservices.com https://www.googletagmanager.com https://s.ytimg.com https://cdnjs.cloudflare.com https://www.youtube.com 'unsafe-inline'; object-src 'none'; frame-ancestors 'self'; frame-src 'self' https://vars.hotjar.com https://www.youtube.com; form-action 'self'; style-src 'self' https://use.fontawesome.com https://cdnjs.cloudflare.com 'unsafe-inline'; font-src 'self' https://use.fontawesome.com; img-src 'self' https://ssl.google-analytics.com https://www.google-analytics.com https://www.google.it https://www.google.com https://www.googletagmanager.com https://i.ytimg.com; connect-src 'self' https://stats.g.doubleclick.net https://in.hotjar.com https://www.google-analytics.com https://d70ggs2qfh.execute-api.eu-west-1.amazonaws.com
Liferay-Portal: Liferay Portal Enterprise Edition 6.2.10 EE GA1 (Newton / Build 6210 / November 1, 2013)
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1
Vary: Accept-Encoding
Content-Encoding: gzip

Gdfsuez.it Domain Nameserver Information

HostIP AddressCountry
c.ns.mailclub.com 87.255.159.64
b.ns.mailclub.eu 85.31.196.158
a.ns.mailclub.fr 195.64.164.8


Need to find out who hosts Gdfsuez.it?


Domain Registration (WhoIs) information for Gdfsuez.it

 *********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://web-whois.nic.it *
* Privacy Information: http://web-whois.nic.it/privacy *
*********************************************************************

Domain: gdfsuez.it
Status: ok
Signed: no
Created: 2007-10-12 11:37:31
Last Update: 2020-03-03 00:50:35
Expire Date: 2021-02-16

Registrant
Organization: ENGIE
Address: 1, Place Samuel De Champlain
Courbevoie
92400
FR
FR
Created: 2015-12-04 15:27:33
Last Update: 2019-06-19 17:03:35

Admin Contact
Name: NOMS DE DOMAINE Responsable
Organization: ENGIE
Address: 1, Place Samuel De Champlain
Courbevoie
92400
FR
FR
Created: 2015-12-04 15:27:33
Last Update: 2019-06-19 17:03:35

Technical Contacts
Name: HOST Master
Organization: SafeBrands
Address: Pole Media de la Belle de Mai
37 rue Guibal
Marseille cedex 03
13356
FR
FR
Created: 2009-09-30 12:52:34
Last Update: 2019-06-28 15:02:20

Registrar
Organization: SafeBrands SAS
Name: MAILCLUB-REG
Web: https://www.safebrands.com
DNSSEC: no

Nameservers
c.ns.mailclub.com
b.ns.mailclub.eu
a.ns.mailclub.fr

Websites with Similar Names

Gdfsuez-energy.ro
Energia este viitorul nostru, să o economisim! | ENGIE
Gdfsuez-pro.fr
Redirection gdfsuez-pro.fr
Gdfsuez.it
ENGIE Italia | Luce, gas, efficienza energetica e servizi
Gdfsuez.ro
Energia este viitorul nostru, să o economisim! | ENGIE
Gdfsuezla.com
HugeDomains.com

Recently Updated Websites

Growthharboradvisors.com (1 second ago.)Genesisturkiye.com (1 second ago.)Annau.com (1 second ago.)Orthodentalplus.com (1 second ago.)Clasificados-auto.com (1 second ago.)Nationwidejeep.com (1 second ago.)Netto.discount (1 second ago.)Socialearthquake.com (1 second ago.)Crystalcitymetro.com (2 seconds ago.)Afimacsmi.com (2 seconds ago.)Wewatchedthat.com (3 seconds ago.)Chicbagtique.com (3 seconds ago.)Kickat55.com (3 seconds ago.)Abogadorapido.net (3 seconds ago.)Locator.ua (4 seconds ago.)Karenwieffering.com (4 seconds ago.)Yourbarrelpick.com (4 seconds ago.)Siagelproductions.com (4 seconds ago.)Massive-breast.com (5 seconds ago.)Nnangels.net (5 seconds ago.)Phoenixarizonadigitalmarketingagency.com (5 seconds ago.)Oxalis-garden.dk (5 seconds ago.)Envato.rathemes.com (5 seconds ago.)Itosplus.com (6 seconds ago.)Eaas-ermoupoli.com (6 seconds ago.)Almustafacatering.com (6 seconds ago.)Touristico.com (6 seconds ago.)J0hnnychavez.com (6 seconds ago.)Sabzdentalclinic.com (6 seconds ago.)Urbannw.net (6 seconds ago.)

Recently Searched Keywords

un soutien (3 seconds ago.)gervonta davis (6 seconds ago.)校园新闻 (11 seconds ago.)nayagan songs download (11 seconds ago.)softcore, solo erotica (12 seconds ago.)leaders activity report (12 seconds ago.)settings slidestoshow (12 seconds ago.)future furniture malaysia (13 seconds ago.)else sessionstorageremoveitemwelcomebarclose localstorageremoveitemwelcomebarclose (14 seconds ago.)compare cryptocurrencies (15 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (16 seconds ago.)ovns (17 seconds ago.)rcog login (20 seconds ago.)recall (21 seconds ago.)800 ft (23 seconds ago.)insurance onlinequote (26 seconds ago.)being myself meaning in malayalam (26 seconds ago.)guia de hoteles (27 seconds ago.)proof (28 seconds ago.)free logo design (30 seconds ago.)автоматический выключатель abb 3п 10а sh203-c10 (32 seconds ago.)item- (32 seconds ago.)kitab cempaka putih (33 seconds ago.)blackberry 10 (34 seconds ago.)otobüs (36 seconds ago.)hairstyle (37 seconds ago.)319066 100 (37 seconds ago.)griya amanah jatinangor (37 seconds ago.)tiền và sinh lời (38 seconds ago.)clamshell boxes (40 seconds ago.)