Geekbox.net  |  The Geekbox | Home of The Geekbox, The Comic Conspiracy, and The Comedy Button
Low trust score  | 

Geekbox.net Website Information

Geekbox.net has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 797,506, a Majestic Rank of 0, a Domain Authority of 39% and is listed in DMOZ.

Geekbox.net is hosted by HostDime.com, Inc. in Florida, Orlando, United States, 32826.
Geekbox.net has an IP Address of 184.171.242.122 and a hostname of oblivion.geekbox.net.

The domain geekbox.net was registered 2 decades 11 months 3 weeks ago by , it was last modified 5 years 1 month 3 weeks ago and currently is set to expire 2 years 11 months 3 weeks ago.


Whois information for geekbox.net

Full Whois Lookup for Geekbox.net Whois Lookup

Domain Name: GEEKBOX.NET
Registry Domain ID: 3390163_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2016-05-22T07:18:19Z
Creation Date: 1998-07-22T04:00:00Z
Registry Expiry Date: 2018-07-21T04:00:00Z
Registrar: Network Solutions, LLC.
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS24649.DIZINC.COM
Name Server: DNS24650.DIZINC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-16T19:25:22Z

Who hosts Geekbox.net?

Geekbox.net Web Server Information

Hosted IP Address:184.171.242.122
Hosted Hostname:oblivion.geekbox.net
Service Provider:HostDime.com, Inc.
Hosted Country:United StatesUS
Location Latitude:28.5887
Location Longitude:-81.1893
Webserver Software:Not Applicable

HTTP Header Analysis for Geekbox.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 30 May 2015 16:08:26 GMT
Server: Apache
X-Powered-By: PHP/5.4.31
X-Pingback: http://www.geekbox.net/blog/xmlrpc.php
Content-Length: 56988
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Geekbox.net?

Geekbox.net Free SEO Report

Website Inpage Analysis for Geekbox.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-5721370784513630
Google Analytics:Not Applicable

Keyword Cloud for Geekbox.net

julycan keepweshellso youyourget freepm 0links a61212 featuressomescottnbsp13listening to ourquestionsstarring ryanintervalbrainbackground ffffff1 a monthpurchaserunning time3comicstimestamp true avatarsmaytweetsffffffavatarsa61212 featuresbackground e81d1d13discount codesidler and charlielistener questions4always don8217t forgethiggins in podcastslivecan keep listeningcolor ffffff tweetsgoogle playcharlie west runningcomickeep listeningjobgeekbox episodeplay musictimestamp true2 type profilehigginsfeedaugnewpmawesome durableheight 175false behavior allweekdownload 8212color ffffffcan help support2012 nbsp17nbsp5conspiracy 8212your purchaseam 0 commentstweakedoutcomic conspiracy 82128220geekbox8221 to getcan helpsponsorchecka61212 features scrollbartimestampcheck out oursidlerhashtagsyou can keepffffff tweetsrss the geekbox2009 nbsp5starring ryan higginswest running timeout ourfalse live falsewidth 195versionamournbsp16 januarydurablefalse hashtagssupportfreereallycomments don8217tmusictrueavatars false behaviordon8217tloop falseoff your purchasehelp6000 width 195shell background e81d1dplay music 8212type profilehiggins bryce larsenryan higginsyoutwtrwidget versiontime 1hbutton60 comments don8217t2013 nbsp17rss the comicwidth0week weyou can helpshell backgroundcharlie westpatreon and hugeplaynbsp7linksbehavior allffffff tweets backgroundprofilefree worldwide shippingbudslittlegoogle play musicbrycewestweek we discussdefenderstrue timestamp true33 off yourbackground e81d1d colortimedurable highquality earrpp 1heighthugebackground0 commentsthanksgood job braincomments10ryan higgins bryce000000hashtags true timestamppodcasts the comictrue avatars falsegooglesee how yourandom picks2009 nbsp4theme shellgeekboxoff youre81d1d color fffffftheme shell backgroundversion 2nbsp18 marchmusic 8212live false175 theme2009 nbsp6ffffff colora61212forget to checkrssbuds soquestions and random2015 nbsp16175 theme shellget free worldwidebryce larsentrue timestampapriltwtrwidget version 2000000 linksavatars falsefalse behaviorconspiracyrandomworldwide shipping9our patreonawesome2014 nbsp18good2 typenbsp6nbsp16features scrollbarhighqualitytoby sidlerdirectreally awesomespoilersweek8217s sponsorlive false hashtagsour patreon campaignscrollbar false loope81d1d color1hryannbsp9pm 0 comments2014 nbsp17loop false livebehaviorour backersfalse hashtags trueear buds socharlienbsp4false loope81d1dam 0height 175 themecomedy buttonseprunningscrollbar falsesupport the showvarpurchase of somemonth you cancampaigndiscount code 8220geekbox82218212 google playgetfree worldwidecomic conspiracy episodeforgetjob brainlittle as 1profile rpp2012 nbsp18falsecomic conspiracytweets background7links a61212brock sagerdownloadseecheck outawesome podcastscolor 0000001color1 intervalaudio usedirect download 8212color 000000 linkscomments as alwaysdirect downloadcode 8220geekbox8221our awesomenovembertwtrwidgetmore1 interval 60008212 episode2allnew twtrwidgetuse the discountaudio2016 nbsp12help supportrpp14marchversion 2 typeyou cansome really awesomenbsp88212 rssoffinterval 6000conspiracy 8212 episodedownload 8212 itunes2015 nbsp15august2014 nbsp16nbsp12we discussear budspodcast8220geekbox82218212 google2010 nbsp4higgins brycemonthwest runningdecembertweets background fffffffalse loop falsepodcasts the geekboxitunes 8212 googlecanour awesome podcastscan supportscrollbarbuds so youfalse livenbsp15posted8212 itunes 8212campaign to seerpp 1 intervalpodcast the comicthanks to allweek8217ssagerhighquality ear budsnew twtrwidget versionpickstweaked audio useshipping and 33patreon campaignlooplistenerbackersalways don8217t8nbsp14highquality earposted by ryan12really awesome durable33 offworldwidekeeptrue avatars16discuss000000 links a61212alwaysdon8217t forgetlarsendurable highqualityfeaturesdiscountmonth you11background ffffff colorsupport the podcaststarringwhereinryan scott2010 nbsp5you can supportoctoberawesome durable highqualityprofile rpp 1toby5juneseptemberwherein wejanuary2016 nbsp14all our backersmusic 8212 rsshashtags trueso you canhuge thanks195 heightwidth 195 heightstarring ryan scottnbsp17 februarycomedylisteningall oursome reallygood jobrss feedsoconspiracy episodeshippingthemecomments don8217t forgetpodcasts2013 nbsp18show this week8217sbrocktype profile rppitunestyperunning time 1hnbsp17interval 6000 widthpatreongame15out our patreonfebruarynbsp18itunes 8212tweaked audiowherein we discussshowearfeatures scrollbar false6000 widthepisodebatman195 height 1758212 itunesffffff color 000000codeuse17

Longtail Keyword Density for Geekbox.net

KeywordsOccurences
itunes 8212 google7
8212 google play7
google play music7
play music 82127
8212 itunes 82127
download 8212 itunes7
podcasts the geekbox7
running time 1h7
direct download 82127
music 8212 rss7
out our patreon7
posted by ryan7
higgins in podcasts7
forget to check7
check out our7
ffffff tweets background6
a61212 features scrollbar6
links a61212 features6
color 000000 links6
tweets background ffffff6
background ffffff color6
ffffff color 0000006
color ffffff tweets6
000000 links a612126
shell background e81d1d6
profile rpp 16
rpp 1 interval6
1 interval 60006
type profile rpp6
2 type profile6
new twtrwidget version6
twtrwidget version 26
version 2 type6
interval 6000 width6
6000 width 1956
theme shell background6
features scrollbar false6
background e81d1d color6
175 theme shell6
height 175 theme6
width 195 height6
195 height 1756
e81d1d color ffffff6
true timestamp true6
false behavior all6
timestamp true avatars6
avatars false behavior6
true avatars false6
scrollbar false loop6
false hashtags true6
hashtags true timestamp6
loop false live6
false loop false6
false live false6
live false hashtags6
all our backers4
little as 14
thanks to all4
patreon and huge4
podcasts the comic4
good job brain4
comic conspiracy episode4
1 a month4
podcast the comic4
week we discuss4
starring ryan higgins4
use the discount4
conspiracy 8212 episode4
comic conspiracy 82124
you can help4
month you can4
can help support4
support the podcast4
west running time3
really awesome durable3
show this week8217s3
support the show3
you can support3
see how you3
tweaked audio use3
discount code 8220geekbox82213
free worldwide shipping3
get free worldwide3
8220geekbox8221 to get3
campaign to see3
our patreon campaign3
comments don8217t forget3
0 comments don8217t3
pm 0 comments3
questions and random3
rss the geekbox3
always don8217t forget3
comments as always3
am 0 comments3
shipping and 333
33 off your3
wherein we discuss3
our awesome podcasts3
listening to our3
can keep listening3
starring ryan scott3
rss the comic3
sidler and charlie3
higgins bryce larsen3
ryan higgins bryce3
you can keep3
so you can3
some really awesome3
purchase of some3
off your purchase3
awesome durable high-quality3
durable high-quality ear3
buds so you3
ear buds so3
high-quality ear buds3
charlie west running3
comic conspiracy15
ryan higgins14
you can11
time 1h7
direct download7
running time7
we discuss7
starring ryan7
download 82127
itunes 82127
8212 rss7
music 82127
google play7
8212 google7
8212 itunes7
play music7
out our7
don8217t forget7
2010 nbsp47
our patreon7
check out7
color 0000006
000000 links6
ffffff color6
interval 60006
background ffffff6
links a612126
a61212 features6
loop false6
false live6
false loop6
scrollbar false6
features scrollbar6
tweets background6
ffffff tweets6
shell background6
background e81d1d6
theme shell6
175 theme6
new twtrwidget6
e81d1d color6
color ffffff6
6000 width6
1 interval6
width 1956
195 height6
height 1756
live false6
profile rpp6
avatars false6
true avatars6
false behavior6
twtrwidget version6
type profile6
version 26
2013 nbsp176
2 type6
0 comments6
rpp 16
behavior all6
true timestamp6
hashtags true6
false hashtags6
geekbox episode6
timestamp true6
2016 nbsp125
2015 nbsp165
ryan scott5
2010 nbsp55
2014 nbsp185
2009 nbsp44
2013 nbsp184
2016 nbsp144
2014 nbsp174
2009 nbsp54
discount code4
huge thanks4
all our4
our backers4
conspiracy episode4
job brain4
comedy button4
good job4
month you4
can help4
listener questions4
toby sidler4
rss feed4
week we4
8212 episode4
help support4
conspiracy 82124
off your4
awesome podcasts3
free worldwide3
get free3
code 8220geekbox82213
audio use3
worldwide shipping3
33 off3
really awesome3
some really3
your purchase3
tweaked audio3
week8217s sponsor3
random picks3
comments don8217t3
pm 03
brock sager3
am 03
can support3
patreon campaign3
always don8217t3
awesome durable3
durable high-quality3
2015 nbsp153
nbsp17 february3
west running3
charlie west3
nbsp16 january3
2014 nbsp163
2012 nbsp173
2012 nbsp183
nbsp18 march3
bryce larsen3
higgins bryce3
buds so3
ear buds3
high-quality ear3
so you3
can keep3
wherein we3
our awesome3
keep listening3
2009 nbsp63
025
false24
ryan19
118
conspiracy16
our16
nbsp1715
comic15
episode14
higgins14
nbsp1813
rss13
nbsp413
podcasts13
ffffff12
212
312
412
you12
512
background12
612
all12
712
812
color12
912
1012
geekbox12
true12
can11
august10
nbsp510
july10
nbsp1610
september9
april9
may9
june9
march9
out9
february9
january9
october8
november8
december8
music8
patreon8
itunes8
week8
theme8
don8217t8
nbsp128
play7
google7
nbsp147
117
new7
starring7
support7
we7
download7
check7
forget7
comics7
posted7
comments7
running7
discuss7
time7
direct7
1h7
interval6
rpp6
scrollbar6
features6
behavior6
loop6
hashtags6
avatars6
a612126
live6
timestamp6
links6
height6
126
136
width6
146
shell6
e81d1d6
tweets6
0000006
profile6
type6
version6
twtrwidget6
awesome6
156
month5
scott5
thanks5
off5
podcast5
nbsp135
nbsp155
your5
toby4
sidler4
always4
show4
defenders4
get4
nbsp64
discount4
feed4
use4
questions4
help4
job4
good4
button4
comedy4
brain4
sep4
little4
backers4
huge4
pm4
listener4
code4
listening4
game4
some4
var3
nbsp93
nbsp83
nbsp73
keep3
buds3
more3
so3
wherein3
163
west3
charlie3
larsen3
spoilers3
aug3
ear3
batman3
bryce3
random3
173
sponsor3
purchase3
shipping3
worldwide3
audio3
8220geekbox82213
free3
week8217s3
see3
sager3
brock3
picks3
high-quality3
durable3
campaign3
really3
am3
tweaked3

What are the nameservers for geekbox.net?

Geekbox.net Domain Nameserver Information

HostIP AddressCountry
dns24649.dizinc.com 184.171.242.123United States United States
dns24650.dizinc.com 184.171.242.124United States United States

Geekbox.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Geekbox.net is a scam?