City of Georgetown Texas

Safety: Low trust score
Year Founded: 1995
Global Traffic Rank: 130,834
Estimated Worth: $234,720



Domain summary

Last updated
2020-11-07
Domain label
georgetown
Domain extension
org
Domain registered:
1995-04-29
Domain updated:
2020-11-07
Global Traffic Rank
130,834
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$234,720
Estimated daily income
$326
Estimated monthly income
$9,916

Rank summary

How is georgetown.org ranked relative to other sites:

Percentage of visits to georgetown.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Georgetown.org registered?
A: Georgetown.org was registered 25 years, 11 months, 1 week, 6 days, 20 hours, 4 minutes, 51 seconds ago on Saturday, April 29, 1995.
Q: When was the WHOIS for Georgetown.org last updated?
A: The WHOIS entry was last updated 5 months, 5 days, 20 hours, 4 minutes, 51 seconds ago on Saturday, November 7, 2020.
Q: What are Georgetown.org's nameservers?
A: DNS for Georgetown.org is provided by the following nameservers:
  • ns1-07.azure-dns.com
  • ns2-07.azure-dns.net
Q: Who is the registrar for the Georgetown.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Georgetown.org?
A: Georgetown.org ranks 130,834 globally on Alexa. Georgetown.org has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Georgetown.org each day?
A: Georgetown.org receives approximately 27,130 visitors and 162,780 page impressions per day.
Q: What IP address does Georgetown.org resolve to?
A: Georgetown.org resolves to the IPv4 address 72.3.237.249.
Q: In what country are Georgetown.org servers located in?
A: Georgetown.org has servers located in the United States.
Q: What webserver software does Georgetown.org use?
A: Georgetown.org is powered by Apache webserver.
Q: Who hosts Georgetown.org?
A: Georgetown.org is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Q: How much is Georgetown.org worth?
A: Georgetown.org has an estimated worth of $234,720. An average daily income of approximately $326, which is roughly $9,916 per month.

Georgetown.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Georgetown.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Georgetown.org

H1 Headings

2 :
  1. City of Georgetown Texas
  2. City News

H2 Headings

10 :
  1. Blood Drive at Recreation Center Nov. 13
  2. I-35 mainlanes close overnight for bridge work Nov. 8-12
  3. City to host household hazardous waste collection event Nov. 18
  4. Runoff election for District 2 council seat Dec. 15
  5. Proposed Voluntary Annexation of 6.478 Acres (Lots 13 and 15 Serenada Country Estates Unit One)
  6. Georgetown Parks and Recreation announces day camps
  7. Fire Stations 6 and 7 to help emergency response
  8. Topics of Interest
  9. Important Information
  10. Special Topics

H3 Headings

1 :
  1. Special Topics

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

46 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2480249-5

Links - Internal

167:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Georgetown.org

librarybuildingonlinepermitseventcity of georgetownresidentialdowntowngeorgetown texasdistrictbilldevelopmentparkshomeswitcher selectedcityfy2021selectedartsread morerecreationvarreportfunctioncenter038culturejqueryswitcherfy2021 draft budgetdraftswitcherpaypermitwatchyouroptionsolidutilitygeorgetownreadtrafficinformationnoneahover0draft budget partschedulepubliccouncilswitcher optionplangpartnovdepartmentdraft budgetbudgetgtvservicesampfy2021 drafttax0 0openspecialbackgroundfffbill utilitybudget partcodetopicsnoticemorecommercialalarmtexas

Who hosts Georgetown.org?

Georgetown.org Hosting Provider Information

Hosted IP Address:72.3.237.249
Hosted Hostname:72.3.237.249
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4963
Location Longitude:-98.4004
Webserver Software:Apache

Is "Rackspace Hosting" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Rackspace Hosting
0.3767%

HTTP Header Analysis for Georgetown.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Nov 2020 06:25:27 GMT
Server: Apache
Link:; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Georgetown.org Domain Nameserver Information

HostIP AddressCountry
ns1-07.azure-dns.com 40.90.4.7
ns2-07.azure-dns.net 64.4.48.7


Need to find out who hosts Georgetown.org?


Domain Registration (WhoIs) information for Georgetown.org

 Domain Name: GEORGETOWN.ORG
Registry Domain ID: D480565-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-06-26T20:07:31Z
Creation Date: 1995-04-29T04:00:00Z
Registry Expiry Date: 2022-04-30T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: City of Georgetown
Registrant State/Province: TX
Registrant Country: US
Name Server: NS1-07.AZURE-DNS.COM
Name Server: NS2-07.AZURE-DNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-04-28T17:14:58Z

Websites with Similar Names

Georg-arena.com
GEORG | Heinrich Georg Maschinenfabrik GmbH
Georg-auernheimer.de
Die Herkunft und Bedeutung der Namen der deutschen Sprache. Sehen Sie sich ihre!
Georg-bernhardt.dvag
Georg Bernhardt – Vermögensberater in Leimen
Georg-buechner-schule.info
Georg-Büchner-Schule – Integrierte Gesamtschule des Main-Kinzig-Kreises
Georg-c.com
Bad, Stahl, Fahrrad: Werkzeug- & Metallhandel in Husum
Georg-dahlhoff.de
Georg Dahlhoff Fotografie - Rheinhessen, Deutschland und mehr...
Georg-design.com
georg design - Werbeagentur - Marke - Web - Design - Münster
Georg-dittrich.com
Home | Georg Dittrich

Recently Updated Websites

One-o-eight.co.uk (2 seconds ago.)Llapnyc.com (3 seconds ago.)Jijverkooptopfunda.info (4 seconds ago.)Teksturepublisher.com (4 seconds ago.)Idahofallsfiber.com (5 seconds ago.)Annal.org (5 seconds ago.)Cremeriaaguascalientes.com.mx (6 seconds ago.)Cats1.xyz (7 seconds ago.)Studyphotoinprague.com (7 seconds ago.)Sd1213.com (8 seconds ago.)Managingyourhealth.com (9 seconds ago.)Rajakasino.com (9 seconds ago.)Weconservepa.info (10 seconds ago.)Guelphglass.ca (12 seconds ago.)Kubet1.com (12 seconds ago.)Deeperstillenneagram.com (12 seconds ago.)Ictoaldomontegalda.com (13 seconds ago.)628845.com (15 seconds ago.)Tre.ltd (15 seconds ago.)Paradisereal.estate (16 seconds ago.)Weddingadventuresphotography.com (18 seconds ago.)Homesandland.ca (19 seconds ago.)Goose.pub (20 seconds ago.)Downeyarc.org (21 seconds ago.)Shiftmywheels.com (22 seconds ago.)Thepostmodernmama.com (22 seconds ago.)Link2listings.com (22 seconds ago.)1337accelerator.com (22 seconds ago.)Mninvestments.net (24 seconds ago.)Eastendhypnosis.com (25 seconds ago.)

Recently Searched Keywords

domovská stránka (1 second ago.)ù„ø¹ø¨ø© ø­ø±ø¨ (1 second ago.)nazwa i logo (2 seconds ago.)adam dowmlsdisclaimermls (3 seconds ago.)lavena (5 seconds ago.)order a sample bag (7 seconds ago.)car maintenance (8 seconds ago.)gallery-slideshow-info gallery-item-titlecomp-jac9f1rs pro-galleryinline-styles (8 seconds ago.)215 1 (9 seconds ago.)sports, games and fun (10 seconds ago.)address commentsmessage submit (11 seconds ago.)border-top-left-radius 5px border-top-right-radius (13 seconds ago.)wrapper2 (14 seconds ago.)calc100 331px (15 seconds ago.)maykivsem (17 seconds ago.)rn background-color (20 seconds ago.)pedagogiczne (22 seconds ago.)admotions (23 seconds ago.)now this stupid (23 seconds ago.)automotive covid-19 (23 seconds ago.)season 1captionthe (25 seconds ago.)porttitor accumsan (26 seconds ago.)tin mi ti (26 seconds ago.)move to kelowna (28 seconds ago.)antes de firmar (29 seconds ago.)tactical bunny (30 seconds ago.)ladyboyweb (31 seconds ago.)sale abu (31 seconds ago.)dimmond (32 seconds ago.)smm агентство инстаграм (34 seconds ago.)