Getgoo.us  |  Free forum - getgoo.us
Low trust score  | 
Free forum Naruto RPG Naruto RP NRP Naruto RPG Naruto RP NRP Naruto RPG Naruto RP NRP Naruto RPG Naruto RP NRP Naruto RPG Naruto RP NRP Naruto RPG Naruto RP NRP




Getgoo.us Website Information

Website Ranks & Scores for Getgoo.us

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:5,709,211
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:31%
DMOZ DMOZ Listing:No

Whois information for getgoo.us

Full Whois Lookup for Getgoo.us Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Getgoo.us. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: GETGOO.US
Domain ID: D10631053-US
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services): whois.godaddy.com
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registrant ID: CR15919899
Registrant Name: Maier Robert
Registrant Organization: exotikweb
Registrant Address1: 51 East Church Street 95e
Registrant City: Orlando
Registrant State/Province: Florida
Registrant Postal Code: 32801
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.4074045333
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Administrative Contact ID: CR15919901
Administrative Contact Name: Johann Brun
Administrative Contact Organization: exotikweb
Administrative Contact Address1: 885 Avenue du Docteur Lefebvre
Administrative Contact City: VILLENEUVE
Administrative Contact State/Province: AM
Administrative Contact Postal Code: 06270
Administrative Contact Country: France
Administrative Contact Country Code: FR
Administrative Contact Phone Number: +33.492021576
Administrative Contact Email: Login to show email
Application Purpose: P1
Administrative Nexus Category: C21
Billing Contact ID: CR15919902
Billing Contact Name: Johann Brun
Billing Contact Organization: exotikweb
Billing Contact Address1: 885 Avenue du Docteur Lefebvre
Billing Contact City: VILLENEUVE
Billing Contact State/Province: AM
Billing Contact Postal Code: 06270
Billing Contact Country: France
Billing Contact Country Code: FR
Billing Contact Phone Number: +33.492021576
Billing Contact Email: Login to show email
Application Purpose: P1
Billing Nexus Category: C21
Technical Contact ID: CR15919900
Technical Contact Name: Johann Brun
Technical Contact Organization: exotikweb
Technical Contact Address1: 885 Avenue du Docteur Lefebvre
Technical Contact City: VILLENEUVE
Technical Contact State/Province: AM
Technical Contact Postal Code: 06270
Technical Contact Country: France
Technical Contact Country Code: FR
Technical Contact Phone Number: +33.492021576
Technical Contact Email: Login to show email
Application Purpose: P1
Technical Nexus Category: C21
Name Server: NS1.MAXNS.NET
Name Server: NS2.MAXNS.NET
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Mon Aug 07 20:02:23 GMT 2006
Domain Expiration Date: Mon Aug 06 23:59:59 GMT 2018
Domain Last Updated Date: Fri Aug 04 08:53:45 GMT 2017
DNSSEC: false

>>>> Whois database was last updated on: Sat Sep 02 02:18:04 GMT 2017

Who hosts Getgoo.us?

Getgoo.us is hosted by OVH SAS in Moscow, Moscow, Russia, 101194.
Getgoo.us has an IP Address of 94.23.154.120 and a hostname of 94-23-154-120.ovh.net.



Getgoo.us Web Server Information

Hosted IP Address:94.23.154.120
Hosted Hostname:94-23-154-120.ovh.net
Service Provider:OVH SAS
Hosted Country:RussiaRU
Location Latitude:55.7485
Location Longitude:37.6184
Webserver Software:unknown

HTTP Header Analysis for Getgoo.us

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 02 Jun 2015 16:50:27 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Cache-Control: max-age=86400, public
Expires: Wed, 03 Jun 2015 16:49:28 GMT
Last-Modified: Tue, 02 Jun 2015 00:00:00 GMT
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Access-Control-Allow-Origin: *
Content-Encoding: gzip


Need to find out who hosts Getgoo.us?

Getgoo.us Free SEO Report

Website Inpage Analysis for Getgoo.us

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-6076490735402665
Google Analytics:Not Applicable

Keyword Cloud for Getgoo.us

gamingfreeonlineowners forumownerscreativebookscommunityforumscreative misfitswwrailwarsstarmisfitskylohometaggerscreateworldnewsfixinternetfree forumsoccergetgoousforum asofcreate a freeowners forum asofplaceforumcricketpasswordsstar warsdynastyhinariforum free forumasoftexasmotorhomesoftwaresforum free

Longtail Keyword Density for Getgoo.us

KeywordsOccurences
forum free forum4
owners forum asof3
create a free3
free forum12
forum free4
star wars3
forum asof3
creative misfits3
owners forum3
forum25
free13
forums13
getgoous8
owners6
cricket5
home5
wars5
world5
create5
community4
place4
soccer4
internet4
taggers4
online4
texas3
asof3
motorhome3
kylo3
star3
dynasty3
softwares3
passwords3
misfits3
creative3
books3
hinari3
wwrail3
gaming3
newsfix3

What are the nameservers for getgoo.us?

Getgoo.us Domain Nameserver Information

HostIP AddressCountry
ns1.dnspro.org 74.86.112.130United States United States
ns2.dnspro.org 94.23.150.222Netherlands Netherlands

Getgoo.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Getgoo.us is a scam?