Geworld.net Favicon Geworld.net

Geworld.net Website Thumbnail
Checking...
GE World - George Endo's Blog
Low trust score
Add a review Change category Claim this site
George Endo's Blog


Domain summary

Domain label
geworld
Domain extension
net
Domain registered:
2019-05-08
Domain updated:
2020-04-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is geworld.net ranked relative to other sites:

Percentage of visits to geworld.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Geworld.net registered?
A: Geworld.net was registered 1 year, 5 months, 2 weeks, 8 hours, 29 minutes, 49 seconds ago on Wednesday, May 8, 2019.
Q: When was the WHOIS for Geworld.net last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 8 hours, 29 minutes, 49 seconds ago on Friday, April 24, 2020.
Q: What are Geworld.net's nameservers?
A: DNS for Geworld.net is provided by the following nameservers:
  • ns1.speedydns.net
  • ns2.speedydns.net
Q: Who is the registrar for the Geworld.net domain?
A: The domain has been registered at DROPCATCH.COM 385 LLC.
Q: What is the traffic rank for Geworld.net?
A: Geworld.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Geworld.net each day?
A: Geworld.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Geworld.net resolve to?
A: Geworld.net resolves to the IPv4 address 173.237.136.198.
Q: In what country are Geworld.net servers located in?
A: Geworld.net has servers located in the United States.
Q: What webserver software does Geworld.net use?
A: Geworld.net is powered by Nginx/1.18.0 webserver.
Q: Who hosts Geworld.net?
A: Geworld.net is hosted by Colo4, LLC in Texas, Austin, United States, 78754.
Q: How much is Geworld.net worth?
A: Geworld.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Geworld.net?

Geworld.net Hosting Provider Information

Hosted IP Address:173.237.136.198
Hosted Hostname:uscentral8.myserverhosts.com
Service Provider:Colo4, LLC
Hosted Country:United StatesUS
Location Latitude:30.3402
Location Longitude:-97.6649
Webserver Software:nginx/1.18.0

Is "Colo4, LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Geworld.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.18.0
Date: Tue, 29 Sep 2020 02:16:25 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link:; rel="https://api.w.org/"
Content-Encoding: gzip

Geworld.net Domain Nameserver Information

HostIP AddressCountry
ns1.speedydns.net 174.37.183.108
ns2.speedydns.net 50.22.35.226


Need to find out who hosts Geworld.net?


WhoIs information for Geworld.net

 Domain Name: GeWorld.net
Registry Domain ID: 2388767853_DOMAIN_NET-VRSN
Registrar WHOIS server: whois.NameBright.com
Registrar URL: http://www.NameBright.com
Updated Date: 2020-04-24T00:00:00.000Z
Creation Date: 2019-05-08T18:27:40.000Z
Registrar Registration Expiration Date: 2021-05-08T00:00:00.000Z
Registrar: DropCatch.com 385 LLC
Registrar IANA ID: 1796
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.7204960020
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Private Registration
Registrant Organization:
Registrant Street: 2635 Walnut Street
Registrant City: Denver
Registrant State/Province: CO
Registrant Postal Code: 80205
Registrant Country: US
Registrant Phone: +1.7204960020
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Private Registration
Admin Organization:
Admin Street: 2635 Walnut Street
Admin City: Denver
Admin State/Province: CO
Admin Postal Code: 80205
Admin Country: US
Admin Phone: +1.7204960020
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Private Registration
Tech Organization:
Tech Street: 2635 Walnut Street
Tech City: Denver
Tech State/Province: CO
Tech Postal Code: 80205
Tech Country: US
Tech Phone: +1.7204960020
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1.speedydns.net
Name Server: ns2.speedydns.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net
>>> Last update of WHOIS database: 2020-07-05T03:20:53.354Z

Geworld.net Free SEO Report

Website Inpage Analysis for Geworld.net

H1 Headings

1 :
  1. GE World

H2 Headings

6 :
  1. What You Need to Do About NJ Diet Before It Is Too Late
  2. The Foolproof Nj Diet Strategy
  3. New Step by Step Roadmap for NJ Diet
  4. The Secret of Firewall Solutions for Small Business
  5. New Step by Step Roadmap for Firewall Solutions for Small Business
  6. Onsite in 60 –  Firewall Solutions for Small Business

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

10:
  1. GE World
    http://geworld.net/
  2. What You Need to Do About NJ Diet Before It Is Too Late
    http://geworld.net/2019/09/28/what-you-need-to-do-about-nj-diet-before-it-is-too-late/
  3. Charles
    http://geworld.net/author/chummer2/
  4. Uncategorized
    http://geworld.net/category/uncategorized/
  5. The Secret of Firewall Solutions for Small Business
    http://geworld.net/2019/06/17/the-secret-of-firewall-solutions-for-small-business/
  6. September 2019
    http://geworld.net/2019/09/
  7. June 2019
    http://geworld.net/2019/06/
  8. Log in
    http://geworld.net/wp-login.php
  9. Entries RSS
    http://geworld.net/feed/
  10. Comments RSS
    http://geworld.net/comments/feed/

Links - Internal (nofollow)

1:
  1. Log in
    http://geworld.net/wp-login.php

Links - Outbound

5:
  1. NJ Diet
    http://mynuvo.com
  2. NJ Diet Center
    https://www.consumerhealthdigest.com/weight-loss-reviews/nj-diet.html
  3. firewall solutions for small business
    http://onsitein60.com/firewall-management/
  4. WordPress.org
    https://wordpress.org/
  5. ThemeCountry
    https://themecountry.com

Links - Outbound (nofollow)

0:

Keyword Cloud for Geworld.net

you oughtbusinessesdownmenhaslowjobyou needplanbusinessuncategorizedfatit8217sablecenterlikedoyou protectsurenj dietstep by steponesolutions for smallidealoverchoiceheremostanotherstrategyaimyour companyyour businesskeeppeoplesmallyou8217reprovidesimplysecuritydo about njbecomesmall businessdietuphelphealthlotfirewallisn8217tdietsstepmayfewadvancedtimewayoncestep roadmapnj diet beforesecret of firewallvarioustooprogramcanfirewallsoughtpoundsseveralsecretiftherevpnshedcompanynjyou canbeforeweightgetacupunctureyourhaveprotectiondiet beforeneed to doneedmanagementshouldfirewall solutionsnotyougoingyou havebodyquitealsoprotectnewdiet centerroadmapnetworksosamerathermightnoif youwhichanyprogramscybersecuritysolutionsmany

Longtail Keyword Density for Geworld.net

KeywordsOccurences
solutions for small8
need to do4
do about nj4
nj diet before4
secret of firewall4
step by step3
nj diet10
small business10
firewall solutions8
your company7
if you5
you can5
you need4
diet before4
you have4
step roadmap3
diet center3
you ought3
your business3
you protect3
you60
your32
firewall25
diet19
business17
small13
security13
weight12
can12
solutions11
company10
nj10
it8217s10
have10
network10
not10
there9
if8
get7
most7
may7
do7
program7
has6
step6
one6
help5
too5
ought5
before5
which5
new5
provide5
any5
quite5
pounds5
protect5
going5
firewalls5
aim4
secret4
sure4
here4
health4
vpn4
people4
cybersecurity4
so4
men4
protection4
center4
you8217re4
able4
down4
once4
up4
body4
need4
many4
shed3
simply3
should3
advanced3
way3
businesses3
keep3
various3
fat3
management3
plan3
low3
strategy3
ideal3
time3
uncategorized3
become3
might3
choice3
isn8217t3
roadmap3
few3
another3
like3
rather3
job3
diets3
no3
acupuncture3
several3
also3
lot3
same3
over3
programs3

Geworld.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Geworld.net is a scam?

Websites with Similar Names

Gewora.net
Gewora | Software development and IT consulting
Geworld.ge
Geworld.ge
Geworld.net
GE World - George Endo's Blog

Recently Updated Websites

Happinessloveandmoney.com 1 second ago.Buyer2owner.com 1 second ago.Jamieteachenor.com 2 seconds ago.Harleyradio.com 2 seconds ago.Swordssailing.ie 3 seconds ago.Crasqi.com 4 seconds ago.Djentel.com 4 seconds ago.Textmarket.pl 4 seconds ago.Thomastonctoiltankremoval.com 5 seconds ago.Thedistrictateastover.org 5 seconds ago.3488807.com 6 seconds ago.Marsans.com 6 seconds ago.Backalleybbqdc.com 7 seconds ago.Xadsldp.com 7 seconds ago.Rematedirecto.com 7 seconds ago.Joebolster.com 7 seconds ago.Bluesky-destinations.com 8 seconds ago.Tybermedical.com 8 seconds ago.Saintpaulshortsales.com 9 seconds ago.Theatreguy.com 9 seconds ago.Hinsdalecaucus.org 9 seconds ago.Rumahjogjaindonesia.com 9 seconds ago.Alliedsafetygroup.com 10 seconds ago.Medadv.info 10 seconds ago.Polkcountyhighschool.com 10 seconds ago.Cityofalamosa.org 10 seconds ago.Bankslawfirm.us 10 seconds ago.Humeslaw.org 11 seconds ago.Epictrending.com 11 seconds ago.Luftschutz-bunker.de 12 seconds ago.