Girlfriends.xxx  |  Girlfriends.xxx
Low trust score  | 
What makes Girlfriends.xxx so different from all the free lesbian porn videos you find online? How about the fact that these are gorgeous girls filming their lovers, snapping some selfies and sharing intimate moments with a community of other great gals who are just as into all of it as you are?! Check Us Out!

Girlfriends.xxx Website Information

Girlfriends.xxx has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 403,493, a Majestic Rank of 997,059, a Domain Authority of 29% and is not listed in DMOZ.

Girlfriends.xxx is hosted by MOJOHOST in Michigan, Franklin, United States, 48025.
Girlfriends.xxx has an IP Address of 184.94.149.8 and a hostname of 184.94.149.8.

The domain girlfriends.xxx was registered 7 years 5 months 2 weeks ago by , it was last modified 201 decades 8 years 10 months ago and currently is set to expire 201 decades 8 years 10 months ago.


Whois information for girlfriends.xxx

Full Whois Lookup for Girlfriends.xxx Whois Lookup

Domain Name: GIRLFRIENDS.XXX
Registry Domain ID: D765483-AGRS
Registrar WHOIS Server:
Registrar URL: http://www.meshdigital.com
Updated Date: 2017-05-09T19:45:08Z
Creation Date: 2012-02-03T20:06:28Z
Registry Expiry Date: 2023-02-03T20:06:28Z
Registrar Registration Expiration Date:
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C17657053-AGRS
Registrant Name: Lewis Thomas
Registrant Organization: Really Useful Limited
Registrant Street: Elisky Junkove 15452
Registrant Street: Hostivar
Registrant City: Prague
Registrant State/Province: Prague
Registrant Postal Code: 10200
Registrant Country: CZ
Registrant Phone: +420.776600003
Registrant Phone Ext:
Registrant Fax: +420.776600003
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C17657053-AGRS
Admin Name: Lewis Thomas
Admin Organization: Really Useful Limited
Admin Street: Elisky Junkove 15452
Admin Street: Hostivar
Admin City: Prague
Admin State/Province: Prague
Admin Postal Code: 10200
Admin Country: CZ
Admin Phone: +420.776600003
Admin Phone Ext:
Admin Fax: +420.776600003
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C17657053-AGRS
Tech Name: Lewis Thomas
Tech Organization: Really Useful Limited
Tech Street: Elisky Junkove 15452
Tech Street: Hostivar
Tech City: Prague
Tech State/Province: Prague
Tech Postal Code: 10200
Tech Country: CZ
Tech Phone: +420.776600003
Tech Phone Ext:
Tech Fax: +420.776600003
Tech Fax Ext:
Tech Email: Login to show email
Server: SDNS3.ULTRADNS.COM
Name Server: SDNS3.ULTRADNS.ORG
Name Server: SDNS3.ULTRADNS.BIZ
Name Server: SDNS3.ULTRADNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-16T13:00:23Z

Who hosts Girlfriends.xxx?

Girlfriends.xxx Web Server Information

Hosted IP Address:184.94.149.8
Hosted Hostname:184.94.149.8
Service Provider:MOJOHOST
Hosted Country:United StatesUS
Location Latitude:42.522
Location Longitude:-83.306
Webserver Software:Not Applicable

HTTP Header Analysis for Girlfriends.xxx

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 05 Sep 2015 02:00:22 GMT
Server: Apache
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Content-Length: 3597
Content-Type: text/html


Need to find out who hosts Girlfriends.xxx?

Girlfriends.xxx Free SEO Report

Website Inpage Analysis for Girlfriends.xxx

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Girlfriends.xxx

pleasurejoinnowpaula shynbspjolivideosmarchquerylickingviewdaisywoodlandgirlfriendsallanie darling luciaaccess11 2017girlfriends januarycrystalfebruarybrunettewoodland walkyennacaitlinshavedgirlfriends decemberpussy4 2017reddaphne angelnbspblacknbspstrappussy eatingeach otherbambi jolidenvilenbsp4girlfriends februarytheiramygirlfriends march9bambikira zenbigeachbugnopreset2shaved pussy8eating woodland walkdarling luciaobjecttwainnbspgirlsceneslesbianyoujanuarymodelsifsensual2 scenesshynbspnewdarling lucia denvilenbspanie darlingcristalpussy lickingeatingbabesgorgeous3stockingsdecemberher22 2017lady bugnikitachrissydarlingterrapaulaalexis crystalstudenthome70sitelucia denvilenbspshyanieamy redblondesexkirazen1luciagirlfriends aprilothergetcristal caitlinpussy eating woodlandteenpaula shy2017 brunetteladyvictoriawalk5angelnbspdaphneeating woodlandblack6terra twainnbspyenna blacknbspaprilalexisgirlsview all

Longtail Keyword Density for Girlfriends.xxx

KeywordsOccurences
darling lucia denvilenbsp4
anie darling lucia4
eating woodland walk3
pussy eating woodland3
anie darling8
pussy eating8
kira zen7
girlfriends april6
girlfriends december5
alexis crystal5
girlfriends january4
girlfriends march4
darling lucia4
2 scenes4
4 20174
girlfriends february4
lucia denvilenbsp4
shaved pussy4
amy red3
daphne angelnbsp3
pussy licking3
cristal caitlin3
2017 brunette3
each other3
yenna blacknbsp3
22 20173
paula shynbsp3
bambi joli3
lady bug3
view all3
eating woodland3
11 20173
terra twainnbsp3
paula shy3
woodland walk3
girlfriends34
028
pussy22
scenes15
query10
eating9
kira8
all8
anie8
darling8
alexis7
zen7
16
april6
paula6
26
strap6
their6
lady6
view6
licking5
daphne5
35
no-preset5
sex5
45
55
december5
lesbian5
crystal5
her5
each5
nikita4
victoria4
brunette4
lucia4
red4
daisy4
shaved4
access4
march4
you4
january4
videos4
big4
denvilenbsp4
blacknbsp4
if4
64
february4
terra4
cristal3
teen3
caitlin3
yenna3
73
now3
blonde3
new3
83
get3
object3
babes3
join3
models3
angelnbsp3
chrissy3
sensual3
93
amy3
stockings3
black3
other3
girl3
pleasure3
shynbsp3
site3
home3
bambi3
joli3
gorgeous3
bug3
walk3
twainnbsp3
shy3
student3
woodland3
girls3

What are the nameservers for girlfriends.xxx?

Girlfriends.xxx Domain Nameserver Information

HostIP AddressCountry
sdns3.ultradns.com 156.154.140.3United States United States
sdns3.ultradns.org 156.154.143.3United States United States
sdns3.ultradns.biz 156.154.142.3United States United States
sdns3.ultradns.net 156.154.141.3United States United States

Girlfriends.xxx Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Girlfriends.xxx is a scam?