High trust score |
GlowHost offers the best shared web hosting, reseller hosting and dedicated server experience on the Internet. Get two months free with coupon: 2FREEMONTHS
Glowhost.com Website Information
Website Ranks & Scores for Glowhost.com
 Statvoo Rank: | G |
 Alexa Rank: | 396,461 |
 Majestic Rank: | 135,151 |
 Domain Authority: | 61% |
 DMOZ Listing: | No |
Domain Information for Glowhost.com
| Domain Registrar: | ONLINENIC, INC.  |
|---|---|
| Registration Date: | 2002-03-15 1 decade 6 years 8 months ago |
| Last Modified: | 2014-10-28 4 years 1 month 1 week ago |
| Expiration Date: | 2020-03-15 1 year 2 months 4 weeks from now |
Who hosts Glowhost.com?
Glowhost.com is hosted by WestHost, Inc. in Utah, Providence, United States, 84332.
Glowhost.com has an IP Address of 209.95.38.67 and a hostname of yogurt.glowhost.com and runs Apache web server.
Glowhost.com Web Server Information
| Hosted IP Address: | 209.95.38.67 |
| Hosted Hostname: | yogurt.glowhost.com |
| Service Provider: | WestHost, Inc. |
| Hosted Country: |  US |
| Location Latitude: | 41.6929 |
| Location Longitude: | -111.8147 |
| Webserver Software: | Apache |
HTTP Header Analysis for Glowhost.com
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Date: | Tue, 06 Feb 2018 22:16:44 GMT |
| Server: | Apache |
| X-Pingback: | https://glowhost.com/xmlrpc.php |
| Link: | |
| Access-Control-Allow-Origin: | * |
| Access-Control-Allow-Credentials: | true |
| Access-Control-Allow-Methods: | POST, GET, OPTIONS, DELETE, PUT |
| Access-Control-Allow-Headers: | x-requested-with, Content-Type, origin, authorization, accept, client-security-token |
| Expires: | Tue, 06 Feb 2018 23:16:45 GMT |
| X-UA-Compatible: | IE=Edge,chrome=1 |
| Access-Control-Max-Age: | 1000 |
| X-Frame-Options: | SAMEORIGIN |
| Last-Modified: | Tue, 06 Feb 2018 22:16:45 GMT |
| Vary: | Accept-Encoding,User-Agent |
| Content-Encoding: | gzip |
| Cache-Control: | private, must-revalidate |
| Content-Length: | 14411 |
| Connection: | close |
| Content-Type: | text/html; charset=utf-8 |
Need to find out who hosts Glowhost.com?
Glowhost.com Free SEO Report
Website Inpage Analysis for Glowhost.com
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Glowhost.com
compare plansiffullyyouarticle div divdomainsonlineredundant clouddomain registrationweb hostingcheapvarmainstaff itemtopmoscreenvirtualmonthlysemidedicatedfreewebsite builderweb hosting service038hosting servicesfigure topuptime monitoringgetago viavsserveryour owndiskshared hostingscreen and maxwidthpricingif you2truepdflagsmonitoringfaqallcheap domainunlimited hostingsrcwantampdedicatedtplmeetthestaff mainstaffonewrapownpercompanylearn morehosting plansfully managedseecloud hostingweb3glowhostbuilderdivcdnpridedicatedmanaged dedicated serversanythansitelearnsolutionstextalignappsdisk spaceplansfree domaincloudvideoresellermarginemailtplmeetthestaffoptionsrepairtraditionaltextalign centerhostingarticlemedia screenregistrationyour siteserversunlimitedwidthyoursemidedicated serversincludedbusinessuptimemanageddatacenterprivatesslinformationcomparenameslahacknow0moreitemavailablecenterreseller hosting5pxwhite labeltextjavascriptnonefigureitem figuredomain namehosting serviceagootheroutpridedicated pdflagsdomainbrandssupportyou wantdiv divweb siteoursecurityjustarticle divcontactlabeldhfiltersdedicated serverspadding1mainstaff item figureservicesimportantredundantmaxwidthwhiteviadatatplmeetthestaff mainstaff itemitem figure toptrademarksmainstaffgreenmediavirtual dedicatedfree domain namelesswebsitebranddhtabsservicesitessharedmanaged dedicatedspacewe
Longtail Keyword Density for Glowhost.com
| Keywords | Occurences |
|---|---|
| screen and max-width | 8 |
| tpl-meet-the-staff main-staff item | 7 |
| main-staff item figure | 5 |
| item figure top | 5 |
| managed dedicated servers | 3 |
| free domain name | 3 |
| web hosting service | 3 |
| article div div | 3 |
| web hosting | 10 |
| dedicated servers | 8 |
| shared hosting | 8 |
| tpl-meet-the-staff main-staff | 8 |
| media screen | 8 |
| main-staff item | 7 |
| reseller hosting | 6 |
| free domain | 6 |
| domain name | 6 |
| figure top | 5 |
| managed dedicated | 5 |
| item figure | 5 |
| hosting services | 5 |
| hosting plans | 4 |
| semi-dedicated servers | 4 |
| compare plans | 4 |
| domain registration | 4 |
| fully managed | 4 |
| learn more | 4 |
| your own | 4 |
| you want | 4 |
| if you | 3 |
| your site | 3 |
| div div | 3 |
| article div | 3 |
| cheap domain | 3 |
| web site | 3 |
| text-align center | 3 |
| website builder | 3 |
| redundant cloud | 3 |
| ago via | 3 |
| unlimited hosting | 3 |
| disk space | 3 |
| virtual dedicated | 3 |
| uptime monitoring | 3 |
| white label | 3 |
| cloud hosting | 3 |
| hosting service | 3 |
| pridedicated pdflags | 3 |
| hosting | 58 |
| glowhost | 28 |
| domain | 23 |
| your | 23 |
| web | 22 |
| free | 17 |
| servers | 15 |
| dedicated | 15 |
| services | 14 |
| plans | 14 |
| our | 14 |
| cloud | 13 |
| you | 12 |
| managed | 11 |
| shared | 11 |
| media | 10 |
| site | 10 |
| more | 10 |
| reseller | 10 |
| server | 9 |
| get | 9 |
| service | 9 |
| all | 9 |
| main-staff | 8 |
| screen | 8 |
| max-width | 8 |
| less | 8 |
| tpl-meet-the-staff | 8 |
| compare | 7 |
| 7 | |
| support | 7 |
| item | 7 |
| 038 | 7 |
| 0 | 7 |
| name | 6 |
| top | 6 |
| unlimited | 6 |
| virtual | 6 |
| var | 6 |
| div | 6 |
| 1 | 6 |
| company | 5 |
| semi-dedicated | 5 |
| apps | 5 |
| uptime | 5 |
| figure | 5 |
| faq | 5 |
| important | 5 |
| website | 5 |
| center | 5 |
| monitoring | 5 |
| available | 5 |
| if | 5 |
| domains | 5 |
| sites | 5 |
| registration | 5 |
| see | 4 |
| mo | 4 |
| own | 4 |
| want | 4 |
| now | 4 |
| fully | 4 |
| redundant | 4 |
| learn | 4 |
| amp | 4 |
| brand | 4 |
| wrap | 4 |
| 2 | 4 |
| pricing | 4 |
| private | 4 |
| builder | 4 |
| business | 4 |
| cheap | 4 |
| repair | 4 |
| contact | 4 |
| ssl | 4 |
| other | 4 |
| pridedicated | 3 |
| trademarks | 3 |
| any | 3 |
| none | 3 |
| dhtabs | 3 |
| traditional | 3 |
| dhfilters | 3 |
| padding | 3 |
| pdflags | 3 |
| text-align | 3 |
| margin | 3 |
| 5px | 3 |
| true | 3 |
| width | 3 |
| textjavascript | 3 |
| src | 3 |
| article | 3 |
| cdn | 3 |
| one | 3 |
| brands | 3 |
| just | 3 |
| online | 3 |
| data | 3 |
| hack | 3 |
| per | 3 |
| than | 3 |
| datacenter | 3 |
| green | 3 |
| 3 | 3 |
| monthly | 3 |
| disk | 3 |
| space | 3 |
| out | 3 |
| via | 3 |
| included | 3 |
| video | 3 |
| white | 3 |
| label | 3 |
| options | 3 |
| sla | 3 |
| we | 3 |
| vs | 3 |
| information | 3 |
| solutions | 3 |
| ago | 3 |
| security | 3 |
What are the nameservers for glowhost.com?
Glowhost.com DNS Record Analysis DNS Lookup
| Host | Type | TTL | Extra |
|---|---|---|---|
| f | f | f | IP: f Priority: f Target: f TXT: f CPU: f OS: f MNAME: f RNAME: f Serial: f Refresh: f Retry: f Expire: f IPV6: f MASKLEN: f Chain: f Weight: f Port: f Order: f Pref: f Flags: f Services: f REGEX: f Replacement: f |