Glowhost.com Review - GlowHost.com - Web Hosting Services - Reseller Hosting - Dedicated Servers - Cloud Hosting5561
Glowhost.com
5 out of 5 based on 61 user ratings.
Glowhost.com  |  GlowHost.com - Web Hosting Services - Reseller Hosting - Dedicated Servers - Cloud Hosting
High trust score  | 
GlowHost offers the best shared web hosting, reseller hosting and dedicated server experience on the Internet. Get two months free with coupon: 2FREEMONTHS




Glowhost.com Website Information

Website Ranks & Scores for Glowhost.com

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:396,461
Majestic Rank Majestic Rank:135,151
Domain Authority Domain Authority:61%
DMOZ DMOZ Listing:No

Domain Information for Glowhost.com

Domain Registrar: ONLINENIC, INC.
Registration Date:2002-03-15  1 decade 6 years 7 months ago
Last Modified:2014-10-28  3 years 11 months 2 weeks ago
Expiration Date:2020-03-15  1 year 4 months 2 weeks from now

Who hosts Glowhost.com?

Glowhost.com is hosted by WestHost, Inc. in Utah, Providence, United States, 84332.
Glowhost.com has an IP Address of 209.95.38.67 and a hostname of yogurt.glowhost.com and runs Apache web server.



Glowhost.com Web Server Information

Hosted IP Address:209.95.38.67
Hosted Hostname:yogurt.glowhost.com
Service Provider:WestHost, Inc.
Hosted Country:United StatesUS
Location Latitude:41.6929
Location Longitude:-111.8147
Webserver Software:Apache
Google Map of 50,12

HTTP Header Analysis for Glowhost.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 06 Feb 2018 22:16:44 GMT
Server: Apache
X-Pingback: https://glowhost.com/xmlrpc.php
Link:; rel="https://api.w.org/", ; rel=shortlink
Access-Control-Allow-Origin: *
Access-Control-Allow-Credentials: true
Access-Control-Allow-Methods: POST, GET, OPTIONS, DELETE, PUT
Access-Control-Allow-Headers: x-requested-with, Content-Type, origin, authorization, accept, client-security-token
Expires: Tue, 06 Feb 2018 23:16:45 GMT
X-UA-Compatible: IE=Edge,chrome=1
Access-Control-Max-Age: 1000
X-Frame-Options: SAMEORIGIN
Last-Modified: Tue, 06 Feb 2018 22:16:45 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: private, must-revalidate
Content-Length: 14411
Connection: close
Content-Type: text/html; charset=utf-8


Need to find out who hosts Glowhost.com?

Glowhost.com Free SEO Report

Website Inpage Analysis for Glowhost.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Glowhost.com

pridedicated pdflagspdflagswebsitefullycompare planstraditionalitem figure topanycentersemidedicatedhackvirtual dedicatedcheapyour siteweb hostinguptime monitoringif youmaxwidthtrademarkswraponlinediv div1free domaincdntextjavascriptnowjustbrandpricingdomainprivatetrueuptimereseller hostingmorearticle divmainstaff itemagohosting servicespridedicatedwebsite builderdisk spacemainstaffhostingbrandsonesecurityownmediamanaged dedicated serverslearntplmeetthestaffsemidedicated serversmodomainsdedicated serverswebcontactthanservicesyou wantdatacenterfigure topservicerepairwantweb site3ouryou038srcallyour ownarticle div divdedicatedwhite labelunlimitedfigurecomparedhtabspaddinglearn morearticleitem figurecloud2viaemailgetdhfiltersshared hostingperregistrationmanaged dedicatedtextalign centermedia screengreenweb hosting serviceredundantfreesupportslamonthlyampplansmanagedifsitewidthhosting plansfully managednamesitestplmeetthestaff mainstaff itemotheravailableitemscreenvsinformation0faqglowhostbusinesscloud hostingservervirtualspaceredundant cloudwhitetopincludedmainstaff item figureresellermargincompanyvarcheap domainhosting serviceserverslabeltplmeetthestaff mainstaffdomain registrationoutscreen and maxwidth5pxtextalignsolutionsyourseeago viabuildersslmonitoringwesharedimportantunlimited hostinglessvideofree domain namenonedataappsdiskdivdomain nameoptions

Longtail Keyword Density for Glowhost.com

KeywordsOccurences
screen and max-width8
tpl-meet-the-staff main-staff item7
main-staff item figure5
item figure top5
managed dedicated servers3
free domain name3
web hosting service3
article div div3
web hosting10
dedicated servers8
shared hosting8
tpl-meet-the-staff main-staff8
media screen8
main-staff item7
reseller hosting6
free domain6
domain name6
figure top5
managed dedicated5
item figure5
hosting services5
hosting plans4
semi-dedicated servers4
compare plans4
domain registration4
fully managed4
learn more4
your own4
you want4
if you3
your site3
div div3
article div3
cheap domain3
web site3
text-align center3
website builder3
redundant cloud3
ago via3
unlimited hosting3
disk space3
virtual dedicated3
uptime monitoring3
white label3
cloud hosting3
hosting service3
pridedicated pdflags3
hosting58
glowhost28
domain23
your23
web22
free17
servers15
dedicated15
services14
plans14
our14
cloud13
you12
managed11
shared11
media10
site10
more10
reseller10
server9
get9
service9
all9
main-staff8
screen8
max-width8
less8
tpl-meet-the-staff8
compare7
email7
support7
item7
0387
07
name6
top6
unlimited6
virtual6
var6
div6
16
company5
semi-dedicated5
apps5
uptime5
figure5
faq5
important5
website5
center5
monitoring5
available5
if5
domains5
sites5
registration5
see4
mo4
own4
want4
now4
fully4
redundant4
learn4
amp4
brand4
wrap4
24
pricing4
private4
builder4
business4
cheap4
repair4
contact4
ssl4
other4
pridedicated3
trademarks3
any3
none3
dhtabs3
traditional3
dhfilters3
padding3
pdflags3
text-align3
margin3
5px3
true3
width3
textjavascript3
src3
article3
cdn3
one3
brands3
just3
online3
data3
hack3
per3
than3
datacenter3
green3
33
monthly3
disk3
space3
out3
via3
included3
video3
white3
label3
options3
sla3
we3
vs3
information3
solutions3
ago3
security3

What are the nameservers for glowhost.com?

Glowhost.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
fffIP: f
Priority: f
Target: f
TXT: f
CPU: f
OS: f
MNAME: f
RNAME: f
Serial: f
Refresh: f
Retry: f
Expire: f
IPV6: f
MASKLEN: f
Chain: f
Weight: f
Port: f
Order: f
Pref: f
Flags: f
Services: f
REGEX: f
Replacement: f

Alexa Traffic Rank for Glowhost.com


Alexa Search Engine Traffic for Glowhost.com