Review - - Web Hosting Services - Reseller Hosting - Dedicated Servers - Cloud Hosting5563
5 out of 5 based on 63 user ratings.  | - Web Hosting Services - Reseller Hosting - Dedicated Servers - Cloud Hosting
High trust score  | 
GlowHost offers the best shared web hosting, reseller hosting and dedicated server experience on the Internet. Get two months free with coupon: 2FREEMONTHS Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:396,461
Majestic Rank Majestic Rank:135,151
Domain Authority Domain Authority:61%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: ONLINENIC, INC.
Registration Date:2002-03-15  1 decade 6 years 8 months ago
Last Modified:2014-10-28  4 years 1 month 1 week ago
Expiration Date:2020-03-15  1 year 2 months 4 weeks from now

Who hosts is hosted by WestHost, Inc. in Utah, Providence, United States, 84332. has an IP Address of and a hostname of and runs Apache web server. Web Server Information

Hosted IP Address:
Service Provider:WestHost, Inc.
Hosted Country:United StatesUS
Location Latitude:41.6929
Location Longitude:-111.8147
Webserver Software:Apache
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 06 Feb 2018 22:16:44 GMT
Server: Apache
Link:; rel="", ; rel=shortlink
Access-Control-Allow-Origin: *
Access-Control-Allow-Credentials: true
Access-Control-Allow-Methods: POST, GET, OPTIONS, DELETE, PUT
Access-Control-Allow-Headers: x-requested-with, Content-Type, origin, authorization, accept, client-security-token
Expires: Tue, 06 Feb 2018 23:16:45 GMT
X-UA-Compatible: IE=Edge,chrome=1
Access-Control-Max-Age: 1000
X-Frame-Options: SAMEORIGIN
Last-Modified: Tue, 06 Feb 2018 22:16:45 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: private, must-revalidate
Content-Length: 14411
Connection: close
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

compare plansiffullyyouarticle div divdomainsonlineredundant clouddomain registrationweb hostingcheapvarmainstaff itemtopmoscreenvirtualmonthlysemidedicatedfreewebsite builderweb hosting service038hosting servicesfigure topuptime monitoringgetago viavsserveryour owndiskshared hostingscreen and maxwidthpricingif you2truepdflagsmonitoringfaqallcheap domainunlimited hostingsrcwantampdedicatedtplmeetthestaff mainstaffonewrapownpercompanylearn morehosting plansfully managedseecloud hostingweb3glowhostbuilderdivcdnpridedicatedmanaged dedicated serversanythansitelearnsolutionstextalignappsdisk spaceplansfree domaincloudvideoresellermarginemailtplmeetthestaffoptionsrepairtraditionaltextalign centerhostingarticlemedia screenregistrationyour siteserversunlimitedwidthyoursemidedicated serversincludedbusinessuptimemanageddatacenterprivatesslinformationcomparenameslahacknow0moreitemavailablecenterreseller hosting5pxwhite labeltextjavascriptnonefigureitem figuredomain namehosting serviceagootheroutpridedicated pdflagsdomainbrandssupportyou wantdiv divweb siteoursecurityjustarticle divcontactlabeldhfiltersdedicated serverspadding1mainstaff item figureservicesimportantredundantmaxwidthwhiteviadatatplmeetthestaff mainstaff itemitem figure toptrademarksmainstaffgreenmediavirtual dedicatedfree domain namelesswebsitebranddhtabsservicesitessharedmanaged dedicatedspacewe

Longtail Keyword Density for

screen and max-width8
tpl-meet-the-staff main-staff item7
main-staff item figure5
item figure top5
managed dedicated servers3
free domain name3
web hosting service3
article div div3
web hosting10
dedicated servers8
shared hosting8
tpl-meet-the-staff main-staff8
media screen8
main-staff item7
reseller hosting6
free domain6
domain name6
figure top5
managed dedicated5
item figure5
hosting services5
hosting plans4
semi-dedicated servers4
compare plans4
domain registration4
fully managed4
learn more4
your own4
you want4
if you3
your site3
div div3
article div3
cheap domain3
web site3
text-align center3
website builder3
redundant cloud3
ago via3
unlimited hosting3
disk space3
virtual dedicated3
uptime monitoring3
white label3
cloud hosting3
hosting service3
pridedicated pdflags3

What are the nameservers for DNS Record Analysis DNS Lookup

fffIP: f
Priority: f
Target: f
TXT: f
CPU: f
OS: f
Serial: f
Refresh: f
Retry: f
Expire: f
IPV6: f
Chain: f
Weight: f
Port: f
Order: f
Pref: f
Flags: f
Services: f
Replacement: f

Alexa Traffic Rank for

Alexa Search Engine Traffic for