Homepage | GLSEN

Safety: Low trust score
Year Founded: 1997
Global Traffic Rank: 20,511
Estimated Worth: $660,960



Domain summary

Last updated
2020-11-06
Domain label
glsen
Domain extension
org
Domain registered:
1997-05-15
Domain updated:
2020-11-06
Global Traffic Rank
20,511
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$660,960
Estimated daily income
$918
Estimated monthly income
$27,923

Frequently Asked Questions (FAQ)

Q: When was Glsen.org registered?
A: Glsen.org was registered 24 years, 8 months, 1 week, 16 hours, 18 minutes, 21 seconds ago on Thursday, May 15, 1997.
Q: When was the WHOIS for Glsen.org last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 2 weeks, 2 days, 16 hours, 18 minutes, 21 seconds ago on Friday, November 6, 2020.
Q: What are Glsen.org's nameservers?
A: DNS for Glsen.org is provided by the following nameservers:
  • pdns05.domaincontrol.com
  • pdns06.domaincontrol.com
Q: Who is the registrar for the Glsen.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Glsen.org?
A: Glsen.org ranks 20,511 globally on Alexa. Glsen.org has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Glsen.org each day?
A: Glsen.org receives approximately 76,479 visitors and 458,874 page impressions per day.
Q: What IP address does Glsen.org resolve to?
A: Glsen.org resolves to the IPv4 address 192.237.224.60.
Q: In what country are Glsen.org servers located in?
A: Glsen.org has servers located in the United States.
Q: What webserver software does Glsen.org use?
A: Glsen.org is powered by Nginx webserver.
Q: Who hosts Glsen.org?
A: Glsen.org is hosted by RACKSPACE in United States.
Q: How much is Glsen.org worth?
A: Glsen.org has an estimated worth of $660,960. An average daily income of approximately $918, which is roughly $27,923 per month.

Glsen.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Glsen.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Glsen.org

H1 Headings

1 :
  1. Students Unite in Declaring #BlackLivesMatter

H2 Headings

19 :
  1. Main navigation
  2. Our Work
  3. News & Press
  4. GLSEN Programs
  5. Get involved and join your community, local, or state GLSEN chapter
  6. Recent Activities
  7. International Pronouns Day
  8. State Education Agency Recommendations
  9. 2019 National School Climate Survey Infographics
  10. Supporting LGBTQ+ Students of Color
  11. Recent Research
  12. The 2019 National School Climate Survey
  13. State Education Agency Implementation Resources
  14. LGBTQ-Inclusive and Supportive Teaching: The Experiences of LGBTQ and non-LGBTQ Educators
  15. Native and Indigenous LGBTQ Students
  16. Recent Blog Posts
  17. #ShareYourPronouns FAQ Blog
  18. Supporting LGBTQ+ Students of Color
  19. Introducing the 2020-2021 GLSEN National Student Council cohort

H3 Headings

10 :
  1. FORWARD TOGETHER GLSEN RESPONDS TO 2020 ELECTION RESULTS
  2. JOIN US FOR #RESPECTEVERYWHERE!
  3. LGBTQ+ student experiences revealed in NEW National School Climate Survey
  4. Students Unite in Declaring #BlackLivesMatter
  5. JOIN US
  6. Supreme Court's Espinoza Ruling Devastating for Public Education
  7. Our steps towards making GLSEN an anti-racist organization
  8. Responding to SCOTUS Ruling By Centering the Fight for Black LGBTQ Lives
  9. SUPPORT OUR WORK BY DONATING
  10. JOIN US

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

35 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3654149-4

Links - Internal

80:

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Glsen.org

todaynational school climateread moreany alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrictcouncil condemns policestudentseenoweducatorscarolinanorth dakotaohiooklahomaoregonpennsylvaniarhoderecentreports and briefslegaleducation30thaffirmingstudents of colorhascondemns policeislandsouthadvocateyorknorthreportoctober1nationallivesjerseynew mexiconewhampshirenewcarolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwestglsen039sstate any alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrictmexiconew yorknorth carolinanorthanyour workdakotatennesseetexasutahvermontvirginiawashingtonwest virginiawisconsinwyomingcallsdonateimagestudent councildakotaohiooklahomaoregonpennsylvaniarhode islandsouth carolinasouthenvironmentschool climatecolorresearch reportsnewslgbtqgreater supportgenderdakotaohiooklahomaoregonpennsylvaniarhodelives readalabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrictstoriessupportivecolumbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew hampshirenewjerseynew mexiconew yorknorthlgbtq youthouractionreportspoliceschool climate surveycanyoursupport for blackread the statementmexiconewbrutalitypolice brutalitycouncilcondemns police brutalityuniteyorknorth carolinanorth dakotaohiooklahomaoregonpennsylvaniarhodecondemnswecarolinanorth dakotaohiooklahomaoregonpennsylvaniarhode islandsouthstudent council condemnsreadvirginiawisconsinwyomingallsurveybriefslgbtq studentsislandsouth carolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwestjoinmakeschoolfourblack livesusresources0experiencesblackstatementstudents unitepressyouthchapterschoolsampblogbrutality and callsjunedakotatennesseetexasutahvermontvirginiawashingtonwestcommunitylearnensurecarolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwest virginiawisconsinwyomingnewsupportdayresearchrulingvirtuallgbtqinclusiveinclusivecarolinanorthglsenscouncil condemnsdakotaohiooklahomaoregonpennsylvaniarhode islandsouthsafeislandsouth carolinasouthstate anyjoin uscolumbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanewgiftglsenrightprogramsyorknorth carolinanorthnational studenteverygreatercarolinasouthalabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrict of columbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanewclimateblack lives readjerseynewworkmexiconew yorknorththingsdeclaringtakehampshirenew jerseynewmorestateclimate surveystudentshampshirenew jerseynew mexiconewcalls for greaterunite in declaringweeksolidaritygsanational schoolpolicynational student councilchaptersmake a giftcolumbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew hampshirenew jerseynew

Longtail Keyword Density for Glsen.org

KeywordsOccurences
school climate survey5
reports and briefs4
black lives read4
national student council4
national school climate4
-- -- --4
jerseynew mexiconew yorknorth3
-alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrict of columbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew3
read the statement3
state any -alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrict3
support for black3
calls for greater3
brutality and calls3
condemns police brutality3
council condemns police3
student council condemns3
unite in declaring3
mexiconew yorknorth carolinanorth3
columbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew hampshirenew jerseynew3
make a gift3
hampshirenew jerseynew mexiconew3
carolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwest virginiawisconsinwyoming3
islandsouth carolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwest3
dakotaohiooklahomaoregonpennsylvaniarhode islandsouth carolinasouth3
carolinanorth dakotaohiooklahomaoregonpennsylvaniarhode islandsouth3
yorknorth carolinanorth dakotaohiooklahomaoregonpennsylvaniarhode3
students of color3
lgbtq students10
-- --6
school climate6
our work5
climate survey5
research reports4
lgbtq youth4
lives read4
black lives4
student council4
national student4
national school4
join us4
carolinasouth dakotatennesseetexasutahvermontvirginiawashingtonwest3
council condemns3
read more3
hampshirenew jerseynew3
jerseynew mexiconew3
greater support3
police brutality3
condemns police3
mexiconew yorknorth3
dakotatennesseetexasutahvermontvirginiawashingtonwest virginiawisconsinwyoming3
yorknorth carolinanorth3
students unite3
carolinanorth dakotaohiooklahomaoregonpennsylvaniarhode3
dakotaohiooklahomaoregonpennsylvaniarhode islandsouth3
columbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew hampshirenew3
islandsouth carolinasouth3
state any3
any -alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrict3
lgbtq20
glsen19
students17
image15
our13
013
support10
school10
national10
more9
us9
student9
research9
join8
--8
read7
black7
amp7
state6
educators6
statement6
all6
climate6
reports5
your5
youth5
education5
30th5
we5
blog5
make5
learn5
experiences5
survey5
work5
supportive5
lives5
today4
schools4
every4
council4
june4
now4
right4
can4
report4
october4
glsen039s4
gsa4
resources4
week4
news4
any4
see4
solidarity4
programs4
briefs4
environment3
virtual3
policy3
glsens3
four3
greater3
ensure3
mexiconew3
day3
safe3
brutality3
has3
lgbtq-inclusive3
chapters3
gender3
ruling3
color3
community3
recent3
13
calls3
inclusive3
police3
legal3
carolinanorth3
dakotaohiooklahomaoregonpennsylvaniarhode3
islandsouth3
carolinasouth3
jerseynew3
virginiawisconsinwyoming3
donate3
hampshirenew3
columbiafloridageorgiahawaiiidahoillinoisindianaiowakansaskentuckylouisianamainemarylandmassachusettsmichiganminnesotamississippimissourimontananebraskanevadanew3
-alabamaalaskaarizonaarkansascaliforniacoloradoconnecticutdelawaredistrict3
chapter3
action3
condemns3
take3
press3
gift3
stories3
new3
things3
affirming3
unite3
declaring3
yorknorth3
advocate3
dakotatennesseetexasutahvermontvirginiawashingtonwest3

Who hosts Glsen.org?

Glsen.org Hosting Provider Information

Hosted IP Address:192.237.224.60
Hosted Hostname:192.237.224.60
Service Provider:RACKSPACE
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "RACKSPACE" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
RACKSPACE
0.0601%

HTTP Header Analysis for Glsen.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Length: 95900
Cache-Control: max-age=3600, public
Content-Encoding: gzip
Content-Language: en
Content-Type: text/html; charset=UTF-8
ETag: W/"1604605478"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Thu, 05 Nov 2020 19:44:38 GMT
Link:; rel="revision"
Server: nginx
X-Content-Type-Options: nosniff
X-Drupal-Cache: HIT
X-Drupal-Dynamic-Cache: MISS
X-Frame-Options: SAMEORIGIN
X-Generator: Drupal 8 (https://www.drupal.org)
X-Pantheon-Styx-Hostname: styx-fe4-b-55f8cd4fb8-7qsv5
X-Styx-Req-Id: 5bad1861-1fad-11eb-8cdd-968cc2f2c330
X-Ua-Compatible: IE=edge
X-Served-By: cache-mdw17372-MDW, cache-syd10174-SYD
X-Cache-Hits: 1, 1
X-Timer: S1604633720.234099,VS0,VE1
Accept-Ranges: bytes
Date: Fri, 06 Nov 2020 03:35:20 GMT
Connection: keep-alive
Vary: Accept-Encoding

Glsen.org Domain Nameserver Information

HostIP AddressCountry
pdns05.domaincontrol.com 97.74.110.52
pdns06.domaincontrol.com 173.201.78.52


Need to find out who hosts Glsen.org?


Domain Registration (WhoIs) information for Glsen.org

 Domain Name: GLSEN.ORG
Registry Domain ID: D254422-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-03-17T07:10:06Z
Creation Date: 1997-05-15T04:00:00Z
Registry Expiry Date: 2025-05-16T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: GLSEN
Registrant State/Province: NY
Registrant Country: US
Name Server: PDNS05.DOMAINCONTROL.COM
Name Server: PDNS06.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-06T03:34:21Z

Websites with Similar Names

Glsen.org
Homepage | GLSEN
Glsen.work
glsen.work - Registered at Namecheap.com
Glsencolumbus.org
GLSEN Columbus Home
Glsend.com
GlobalSend
Glsenhv.org
Mid-Hudson Chapter, New York | GLSEN
Glsenneo.com
HugeDomains.com - GlsenNeo.com is for sale (Glsen Neo)
Glsenoregon.net
glsenoregon.net
Glsenors.com
www.1946365.com-伟德国际-[官方网址]
Glsensouthernmaine.org
Glsen Southern Maine | Safe Schools for All
Glsenstore.org
GLSEN Shop to Support LGBTQ Youth

Recently Updated Websites

Funkieshop.com (3 minutes 13 seconds ago.)A-accentplumbing.com (3 minutes 14 seconds ago.)Finkculture.com (3 minutes 15 seconds ago.)Alexilya.net (3 minutes 16 seconds ago.)Magicdev.org (3 minutes 17 seconds ago.)Mibitcoin.news (3 minutes 25 seconds ago.)Ayasofiacuisine.com (3 minutes 25 seconds ago.)Democracy-reporting.org (3 minutes 28 seconds ago.)Liveforthelord.com (3 minutes 35 seconds ago.)Dlblz.com (3 minutes 36 seconds ago.)Yourhomeschoolexpert.com (3 minutes 38 seconds ago.)Ntcacontractorculturesurvey.com (3 minutes 39 seconds ago.)Alisonswordscraft.com (3 minutes 43 seconds ago.)Makeupartistchriscarter.com (3 minutes 47 seconds ago.)Randomcorner.com (3 minutes 48 seconds ago.)Thelondynnb.com (3 minutes 52 seconds ago.)22ndandeverett.com (3 minutes 56 seconds ago.)Patelhost.com (3 minutes 59 seconds ago.)A2ofit.com (4 minutes 2 seconds ago.)Majorgayrimenkul.com (4 minutes 2 seconds ago.)U5u5u.club (4 minutes 3 seconds ago.)Allalavanda.com (4 minutes 8 seconds ago.)Idahomaintenance.com (4 minutes 9 seconds ago.)Webmgz.com (4 minutes 16 seconds ago.)Twistedgenuineparts.com (4 minutes 21 seconds ago.)Costype.net (4 minutes 21 seconds ago.)Lifeandlitblog.com (4 minutes 24 seconds ago.)Birthteacher.com (4 minutes 30 seconds ago.)Coleservices.com (4 minutes 34 seconds ago.)Nsfhukuk.com (4 minutes 38 seconds ago.)

Recently Searched Keywords

parts trailer (1 second ago.)i-style (1 second ago.)list-style-typesquareline-heightnormal body lrichtextcontainer (2 seconds ago.)divination (4 seconds ago.)calc0px 1px (5 seconds ago.)sci fi conventions australia (5 seconds ago.)«т плюс» в чувашии готова к модернизации и концессии (5 seconds ago.)凤吟鸟唱 (6 seconds ago.)2 euro münzen (6 seconds ago.)genel-cagri-merkez (7 seconds ago.)trường th vĩnh lợi (7 seconds ago.)4 tips to leverage your content optimization (8 seconds ago.)ifdelta0 erasecookiesatfilter (9 seconds ago.)niki pea (9 seconds ago.)tacit (10 seconds ago.)congealed salad (10 seconds ago.)padding-left 125rem padding-right (11 seconds ago.)weight lifting gloves (11 seconds ago.)ocheadtop (11 seconds ago.)notre dame chartres (14 seconds ago.)予防・クリーニング (17 seconds ago.)var--offset (17 seconds ago.)fiquei (18 seconds ago.)state bills (19 seconds ago.)限定商品 (19 seconds ago.)34 527 (20 seconds ago.)координтатно-пробивные работы (20 seconds ago.)bloggy mission (21 seconds ago.)hcodense damer (21 seconds ago.) trứng rung tình yêu cao cấp giá rẻ (7) (21 seconds ago.)