gmbsz.hu – Gázipari szabályozás, legyen annak a neve GOMBSZ GMBSZ MBSZ vagy a 3/2020. (I. 13.) ITM-rendelet 1.sz. melléklete, kiegészítve a SZME-G 2020.04.17. Szakági Műszaki Előírással.

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-10
Domain label
gmbsz
Domain extension
hu
Domain registered:
2006-07-07
Domain updated:
2021-05-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is gmbsz.hu ranked relative to other sites:

Percentage of visits to gmbsz.hu from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Gmbsz.hu registered?
A: Gmbsz.hu was registered 14 years, 10 months, 6 days, 21 hours, 32 minutes, 22 seconds ago on Friday, July 7, 2006.
Q: When was the WHOIS for Gmbsz.hu last updated?
A: The WHOIS entry was last updated 3 days, 21 hours, 32 minutes, 22 seconds ago on Monday, May 10, 2021.
Q: What are Gmbsz.hu's nameservers?
A: DNS for Gmbsz.hu is provided by the following nameservers:
  • helium.ns.hetzner.de
  • oxygen.ns.hetzner.com
  • hydrogen.ns.hetzner.com
Q: Who is the registrar for the Gmbsz.hu domain?
A: The domain has been registered at HUNIC.
Q: What is the traffic rank for Gmbsz.hu?
A: Gmbsz.hu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Gmbsz.hu each day?
A: Gmbsz.hu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Gmbsz.hu resolve to?
A: Gmbsz.hu resolves to the IPv4 address 116.202.134.234.
Q: In what country are Gmbsz.hu servers located in?
A: Gmbsz.hu has servers located in the Germany.
Q: What webserver software does Gmbsz.hu use?
A: Gmbsz.hu is powered by Apache webserver.
Q: Who hosts Gmbsz.hu?
A: Gmbsz.hu is hosted by 334,Udyog Vihar in Germany.
Q: How much is Gmbsz.hu worth?
A: Gmbsz.hu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Gmbsz.hu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Gmbsz.hu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Gmbsz.hu

H1 Headings

1 :
  1. Az aktulális GMBSZ és a Szakági Műszaki előirások egységes szerkezetben

H2 Headings

5 :
  1. 1. melléklet a 3/2020. (I. 13.) ITM rendelethez
  2. 2. melléklet a 3/2020. (I. 13.) ITM rendelethez
  3. Az aktuális GMBSZ
  4. Homlokzati kivezetések I.
  5. Rázós ügyek

H3 Headings

31 :
  1. A csatlakozóvezetékek, a felhasználói berendezések és a telephelyi vezetékek műszaki biztonsági szabályzata
  2. Mellékletek
  3. 1.Fogalommeghatározások
  4. 2. A gáz csatlakozóvezetékek, felhasználói berendezések és telephelyi vezeték általános tervezési követelményei
  5. 3. Védőtávolság
  6. 5. A telephelyi vezeték, a csatlakozóvezeték és a fogyasztói vezeték épületen belüli kialakításának követelményei
  7. 6. A hegesztésre vonatkozó sajátos követelmények
  8. 7. A PB-gáz üzemű csatlakozóvezetékek tervezésének sajátos követelményei
  9. 8. A megvalósulási dokumentáció tartalmi követelményei
  10. 9. Gáznyomás-szabályozók elhelyezésének általános követelményei
  11. 10. Nagy-középnyomású házi gáznyomás-szabályozók és egyedi gáznyomás-szabályozó állomások elhelyezésének sajátos követelményei
  12. 11. Házi gáznyomás-szabályozók és egyedi gáznyomás-szabályozó állomások gépészeti követelményei
  13. 12. Házi gáznyomás-szabályozók és egyedi gáznyomás-szabályozó állomások kibocsátási forrásainak zónabesorolása
  14. 13. Az ipari gáznyomás-szabályozó állomásokra vonatkozó sajátos követelmények
  15. 14. A gáznyomás-szabályozó állomásba telepített folyamatvezérlő állomások kialakítására vonatkozó követelmények
  16. 15. A gáznyomás-szabályozó állomás építészeti követelményei
  17. 16. A gáznyomás-szabályozó állomás épületgépészeti követelményei
  18. 17. A gáznyomás-szabályozó állomás gépészeti követelményei
  19. 18. A gáznyomás-szabályozó állomás berendezéseire és szerelvényeire vonatkozó követelmények
  20. 19. A gáznyomás-szabályozó állomás üzembe helyezése előtti nyomáspróbára vonatkozó követelmények
  21. 20. A gáznyomás-szabályozó állomás üzembe helyezésével kapcsolatos követelmények
  22. 21. A nyomáshatároló rendszerekre vonatkozó követelmények
  23. 22. A PB-gáz gáznyomás-szabályozó beépítésére vonatkozó sajátos követelmények
  24. 23. A gáznyomás-szabályozó állomások villamos berendezéseivel szemben támasztott követelmények
  25. 24. A gáznyomás-szabályozó és gázmérő állomásra vonatkozó sajátos követelmények
  26. 25. A gázmérőkre vonatkozó követelmények
  27. 26. A gázfogyasztó készülékek elhelyezésének követelményei
  28. 26. A gázfogyasztó készülékek elhelyezésének követelményei
  29. 27. A vészszellőzőre, valamint az üzemi szellőztető levegő be- és kivezetésére vonatkozó követelmények
  30. 28. Az elkészült csatlakozóvezeték, felhasználói berendezés és telephelyi vezeték kivitelezést követő vizsgálatának követelményei
  31. Olajfogyasztó technológiai rendszerek és gáztárolók műszaki biztonsági szabályzata

H4 Headings

143 :
  1. Az alábbi információk az 1/2020. (I. 13.) rendeletben találhatóak:
  2. 2.1. A tervkészítés során a tervező feladatai:
  3. 2.4. A rajzdokumentációnak tartalmaznia kell a 2.4.1-2.4.5. pontban meghatározott rajzokat és terveket.
  4. 2.5. A tervfelülvizsgálói nyilatkozatra vonatkozó követelmények
  5. 2.6. A csatlakozóvezeték, a fogyasztói vezeték és a telephelyi vezeték sajátos tervezési követelményei
  6. 4. Épületbe történő belépés követelményei csatlakozóvezeték és fogyasztói vezeték esetén
  7. 6.1. Az acél anyagú csatlakozóvezeték, fogyasztói vezeték és telephelyi vezeték hegesztésének sajátos követelményei
  8. 6.2. A PE anyagú csatlakozóvezeték, fogyasztói vezeték és telephelyi vezeték hegesztésének sajátos követelményei
  9. 6.3. A PE hegesztési varratok vizsgálatának és dokumentálásának követelményei
  10. 8.1. A megvalósulási dokumentáció tartalmazza a következőket:
  11. 1. Bevezetés
  12. 2. A gázfogyasztó készülékek telepítésére vonatkozó ábrákon alkalmazott jelölések
  13. 3. „A” típusú gázfogyasztó készülék telepítésére vonatkozó speciális előírások
  14. 3.1. A1 típusú gázfogyasztó készülék
  15. 3.1.2. A2 típusú gázfogyasztó készülék
  16. 3.1.3. A3 típusú gázfogyasztó készülék
  17. 4. „B” típusú gázfogyasztó készülék telepítésére vonatkozó speciális előírások
  18. 4.1. B1 típusú gázfogyasztó készülék
  19. 4.1.1. B11 típusú gázfogyasztó készülék
  20. 4.1.2. B12 típusú gázfogyasztó készülék
  21. 4.1.3. B13 típusú gázfogyasztó készülék
  22. 4.1.4. B14 típusú gázfogyasztó készülék
  23. 4.2. B2 típusú áramlásbiztosítót nem tartalmazó gázfogyasztó készülék
  24. 4.2.1. B21 típusú gázfogyasztó készülék
  25. 4.2.2. B22 típusú, a tűztér után elhelyezkedő ventilátorral ellátott, áramlásbiztosítót nem tartalmazó gázfogyasztó készülék
  26. 4.2.3. B23 típusú, a tűztér előtt elhelyezkedő ventilátorral ellátott, áramlásbiztosítót nem tartalmazó gázfogyasztó készülék
  27. 4.3. B3 típusú, azonos helyiségből ugyanahhoz a közös rendszerű égéstermék-elvezetőhöz csatlakozó áramlásbiztosító nélküli gázfogyasztó készülék
  28. 4.3.1. B31 típusú természetes huzat elvén működő gázfogyasztó készülék
  29. 4.3.2. B32 típusú, tűztér utáni ventilátorral ellátott gázfogyasztó készülék
  30. 4.3.3. B33 típusú, tűztér előtti ventilátorral ellátott gázfogyasztó készülék
  31. 4.4. B4 típusú, áramlásbiztosítót tartalmazó gázfogyasztó készülék
  32. 4.4.1. B41 típusú, természetes huzatú tűztérrel rendelkező gázfogyasztó készülék
  33. 4.4.2. B42 típusú gázfogyasztó készülék
  34. 4.4.3. A B43 típusú gázfogyasztó készülék
  35. 4.4.4. B44 típusú gázfogyasztó készülék
  36. 4.5. B5 típusú gázfogyasztó készülék
  37. 4.5.1. B51 típusú, természetes huzat elvén működő gázfogyasztó készülék
  38. 4.5.2. B52 típusú gázfogyasztó készülék
  39. 4.5.3. B53 típusú gázfogyasztó készülék
  40. 5. „C” típusú gázfogyasztó készülék telepítésére vonatkozó speciális előírások
  41. 6.1. A C11 típusú gázfogyasztó készülék
  42. 6.1.2. C12 típusú gázfogyasztó készülék
  43. 6.1.3. C13 típusú gázfogyasztó készülék
  44. 6.2. C2 típusú gázfogyasztó készülék
  45. 6.2.1. C21 típusú gázfogyasztó készülék
  46. 6.2.2. C22 típusú gázfogyasztó készülék
  47. 6.2.3. C23 típusú gázfogyasztó készülék
  48. 6.3. A C3 típusú gázfogyasztó készülék
  49. 6.3.1. C31 típusú gázfogyasztó készülék
  50. 6.3.2. C32 típusú gázfogyasztó készülék
  51. 6.3.3. C33 típusú gázfogyasztó készülék
  52. 6.4. A C4 típusú gázfogyasztó készülékek
  53. 6.4.1. C41 típusú gázfogyasztó készülék
  54. 6.4.2. C42 típusú gázfogyasztó készülék
  55. 6.4.3. C43 típusú gázfogyasztó készülék
  56. 6.5. C5 típusú gázfogyasztó készülék
  57. 6.5.1. C51 típusú gázfogyasztó készülék
  58. 6.5.2. C52 típusú gázfogyasztó készülék
  59. C53 típusú gázfogyasztó készülék
  60. 6.6. C6típusúgázfogyasztókészülék
  61. 6.6.1. C6(C1) típusú gázfogyasztó készülék
  62. 6.6.1.1. C61(C11) gázfogyasztó készülék
  63. 6.6.1.2. C62(C12) típusú gázfogyasztó készülék
  64. 6.6.1.3. C63(C13) típusú gázfogyasztó készülék
  65. 6.6.2. C6(C2) típusú gázfogyasztó készülék
  66. 6.6.2.1. C61(C21) típusú gázfogyasztó készülék
  67. 6.6.2.2. C62(C22) típusú gázfogyasztó készülék
  68. 6.6.2.3. C63(C23) típusú gázfogyasztó készülék
  69. 6.6.3. C6(C3) típusú gázfogyasztó készülék
  70. 6.6.3.1. C61(C31) típusú gázfogyasztó készülék
  71. 6.6.3.2. C62(C32) típusú gázfogyasztó készülék
  72. 6.6.3.3. C63(C33) típusú gázfogyasztó készülék
  73. 6.6.4. C6(C4) típusú gázfogyasztó készülék
  74. 6.6.4.1. C61(C41) típusú gázfogyasztó készülék
  75. 6.6.4.2. C62(C42) típusú gázfogyasztó készülék
  76. 6.6.4.3. C63(C43) típusú gázfogyasztó készülék
  77. 6.6.5. C6(C5) típusú gázfogyasztó készülék
  78. 6.6.5.1. C61(C51) típusú gázfogyasztó készülék
  79. 6.6.5.2. C62(C52) típusú gázfogyasztó készülék
  80. 6.6.5.3. C63(C53) típusú gázfogyasztó készülék
  81. 6.6.6. C6(C7) típusú gázfogyasztó készülék
  82. 6.6.7. C6(C8) típusú gázfogyasztó készülék
  83. 6.6.7.1. C61(C81) típusú gázfogyasztó készülék
  84. 6.6.7.2. C62(C82) típusú gázfogyasztó készülék
  85. 6.6.7.3. C63(C83) típusú gázfogyasztó készülék
  86. 6.6.8. C6(C9) típusú gázfogyasztó készülék
  87. 6.6.8.1. C61(C91) típusú gázfogyasztó készülék
  88. 6.6.8.2. C62(C92) típusú gázfogyasztó készülék
  89. 6.6.8.3. C63(C93) típusú gázfogyasztó készülék
  90. 6.6.9. C6(C(10)) típusú gázfogyasztó készülék
  91. 6.6.9.1. C62(C(10)2) típusú gázfogyasztó készülék
  92. 6.6.9.2. C63(C(10)3) típusú gázfogyasztó készülék
  93. 6.6.10. C6(C(11)) típusú gázfogyasztó készülék
  94. 6.6.10.1. C62(C(11)2) típusú gázfogyasztó készülék
  95. 6.6.10.2. C63(C(11)3) típusú gázfogyasztó készülék
  96. 6.6.11. C6(C(12)) típusú gázfogyasztó készülék
  97. 6.6.11.1. C62C(12)2) típusú gázfogyasztó készülék
  98. 6.6.11.2. C63C(12)3) típusú gázfogyasztó készülék
  99. 6.6.12. C6(C(13)) típusú gázfogyasztó készülék
  100. 6.6.12.1. C62(C(13)2) típusú gázfogyasztó készülék
  101. 6.6.12.2. C63(C(13)3) típusú gázfogyasztó készülék
  102. 6.6.13. C6(C(14)) típusú gázfogyasztó készülék
  103. 6.6.13.1. C62(C(14)2) típusú gázfogyasztó készülék
  104. 6.6.13.2. C63(C(14)3) típusú gázfogyasztó készülék
  105. 6.6.14. C6(C(15)) típusú gázfogyasztó készülék
  106. 6.6.14.1. C62(C(15)1) típusú gázfogyasztó készülék
  107. 6.6.14.2. C62(C(15)2) típusú gázfogyasztó készülék
  108. 6.6.14.3. C63(C(15)3) típusú gázfogyasztó készülék
  109. 6.7. C7 típusú gázfogyasztó készülék
  110. 6.7.1. C71 típusú gázfogyasztó készülék
  111. 6.7.2. C72 típusú gázfogyasztó készülék
  112. 6.7.3. C73 típusú gázfogyasztó készülék
  113. 6.8. C8 típusú gázfogyasztó készülék
  114. 6.8.1. C81 típusú gázfogyasztó készülék
  115. 6.8.2. C82 típusú gázfogyasztó készülék
  116. 6.8.3. C83 típusú gázfogyasztó készülék
  117. 6.9. C9 típusú gázfogyasztó készülék
  118. 6.9.1. C91 típusú gázfogyasztó készülék
  119. 6.9.2. C92 típusú gázfogyasztó készülék
  120. 6.9.3. C93 típusú gázfogyasztó készülék
  121. 6.10. C(10) típusú gázfogyasztó készülék
  122. 6.10.1. C(10)2 típusú gázfogyasztó készülék
  123. 5.10.2. C(10)3 típusú gázfogyasztó készülék
  124. 6.11. C(11) típusú gázfogyasztó készülék
  125. 6.11.1. C(11)2 típusú gázfogyasztó készülék
  126. 6.11.2. C(11)3 típusú gázfogyasztó készülék
  127. 6.12. C(12) típusú gázfogyasztó készülék
  128. 6.12.1. C(12)2 típusú gázfogyasztó készülék
  129. 6.12.2. C(12)3 típusú gázfogyasztó készülék
  130. 6.13. C(13) típusú gázfogyasztó készülék
  131. 6.13.1. C(13)2 típusú gázfogyasztó készülék
  132. 6.13.2. C(13)3 típusú gázfogyasztó készülék
  133. 6.14. C(14) típusú gázfogyasztó készülék
  134. 6.14.1. C(14)2 típusú gázfogyasztó készülék
  135. 6.14.2. C(14)3 típusú gázfogyasztó készülék
  136. 6.15. C(15) típusú gázfogyasztó készülék
  137. 6.15.1. C(15)1 típusú gázfogyasztó készülék
  138. 6.15.2. C(15)2 típusú gázfogyasztó készülék
  139. 6.15.3. C(15)3 típusú gázfogyasztó készülék
  140. 1. Fogalommeghatározások
  141. 2. Az egyes olajfogyasztó technológiai rendszerekre vonatkozó műszaki biztonsági követelmények
  142. 3. A gáztárolók szerelésére vonatkozó műszaki biztonsági előírások
  143. 4. A gáztárolók vizsgálatára vonatkozó műszaki biztonsági követelmények

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

130 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

28:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Gmbsz.hu

szerkezetek akadlyokc9smnak megfelelvzszintes elrendezsfellltsi helyisgeibe vagy52ce megfelelsgiminstettrendszer gstermkelvezethz csatlakozmikorfellltsi helyisgen tvezetgznyomsszablyoz llomsokpont kvetelmnyeinekephszolgltat telephelyi engedlyes04kellszmegmegoldshaladja megkrlmnyekfellltsi helyisg lgternekvagy az egyszerstetttipus kszlkekmszaki biztonsgivizsglatotbra als brarsznekmretezsttervezse kivitelezse sbratpusaszabadon szereltmagyarmegengedett mrtkjratban helyezkedjen ellegfeljebb kzpnyomskszlk gstermkelvezethz nemtvezet gstermket vezetpontjban ekknt meghatrozottfolyamatvezrlc brahozott rendszerszempontokegyszerstettelleni vdelmt biztostaniltestenifeleljenfldgzeloszt telephelyihelyisgenkzponti rendszer gstermkelvezethzsmk egyike szerinttblzatban megadottkvetelmnyeitnem helyezhet eltartalomjegyzkhezmegfelel elrendezsbenkszlka termszeteskapillrisantelephelyitervtl valhelyezse 2rz s rztvzetekkszlk leveg beszvsrafggen vzszinteskezelsielltninylsokat gykszlk gstermkelvezethzrzrzkel s beavatkozmkdshezkszlk elzr szerelvnykszlka tztr elttkell hogykszlk szabadbagznyomsszablyoz lloms zembec14helyisgben elhelyezetthelyisgnvarrat azonosthelyezhetk elrsz nyitotthelyisgblgzkoncentrcivalamint aztlnyoms rtketartalmartktlevegbevezettvgni skellszmeg 20200417berendezseinekb3csak abban azfldforgalmaz ltaltlnyoms rtke nec2egyedi gznyomsszablyoztrszint alatt2 rszmeg a gyrtznkakkor ezeketclranem rendelkezpadozatnakszellzlevegtrfogatramterhelsiezeketaz egyescsatlakozvezetk srendszer gstermkelvezetbl csakfellltsi helyisgtrtnikhelyisgbeaz acl anyagszakaszbanegyidejleggstermkelvezet egyttestkszlkek amelyeknek nincsenekvezetkeketelltgzfogyaszt kszlkek sbeavatkozdokumentcijamszaki megoldsrendelet 1 mellkletlennie sgyjt szakaszbanvarratgzszerellefvat szellznylsakorbban gstermkelvezetknt hasznltc12 tpus gzfogyaszthasadnyl felletfogyaszti vezetkgstermkelvezetbl csakcsatlakozvezetket fogyasztitilosszemlyekkszlk rszekntaz sszenyitotthogy a gzfogyasztgstermkelvezetknt hasznltkell meghatrozniatervez ltalbetartaniaz plet homlokzatnegyiknek megfelelkell lennievisszahelyezse 2 rszhivatkozssal forgalombagzmr svezetk vagynyomsakszlktl fggetlenl forgalombatervez a robbansveszlyescscsfedezlevegegyenrtktrolsraelrasztsiutni ventiltort tartalmaz3berendezsek solajgtleveg be sggzfogyaszt kszlk biztonsgosilletkes gzipari engedlyesnyomst0hogyanyag csatlakozvezetkals lnekkzs hasznlateltrsllapott is kezelniegyiknekhossza legfeljebbzsaluktsselhelyisg lgternekktstztrhuzat elvnfolyadkpleten bellaeroszolokdokumentcijbanszerelvnyt kellaz ptsggyelkzelbenkszlk helyisgnektvolsgra kellmegvlasztanic1 c3 c5fggleges pletszerkezetitartalmaz gzfogyasztfldgzeloszt telephelyi szolgltatnyitottventiltortkorrzivdelemmel kellnyomshatrolbiztostsval kellhelyzetb5ltal ksztettvagy a pbgzaz aclrobbansi helyzetgzfelhasznl technolgiai rendszernylstlevegbevezet s azllomstelzr szerelvnytberendezsekettelephelyi vezetk sanyagminsgt samelyenalselleni vdelemmelberendezsekbefogadsragzfogyaszt kszlk olyangy kell elhelyeznivezetk telephelyi vezetkszerelvnyt kell beptenifelszerelt gzfogyaszt42ll robbankpes lgtrcsatlakozikacsatlakoztatott7kivezetsselrobbankpes kzegekaz zemi szellztet48rintettsgetervet ksztmszakicsatlakozvezetkbegzfogyaszt kszlk levegmkdsi49tvolsgnakamelyek megakadlyozzkilletkeskzttnincsenek58zemeltetsekvl helyezetttpus egyberendezsek zemtegyenrtk ms mszakiaz estbenkibocst forrsoklevegvelmeghatrozotthzi gznyomsszablyozk scsatlakoztathathelyisgbe vagyismtelt zembe helyezsnylt gsterklsalkalmazott mszaki biztonsgigznyomsszablyozk a csatlakozvezetkbentelephelyi szolgltatteleptett folyamatvezrlnyomsprbabeptsvelgzfogyaszt kszlk fgglegesfelettimegllaptsahomlokzatonamely egy korbbanvagy a 34tztr eltt elhelyezkedindexbenkszlk gsimrett stovbbtartalmivdettzembe helyezse 2levegbevezethz sjrkell harszletesfgglegesaz egyszerstettszempontbl trtnrendelet 1lehetsgeshelyezselennievisszakszlk teleptsnekzembe helyezs elttianyagamkd gzfogyasztkeverkbl lltmrsgtellenrizniltal meghatrozottminstsekfltt kellmagassgavagy a 47s nyomsviszonyok hatsavonatkoz sajtos kvetelmnyekbelsnylsainak elhelyezse nemvezetkekc11 tpusha a gzfogyasztszigetel25nlnem helyezhetfoglaltak alapjnmegakadlyozzk hogytelephelyi engedlyes vagyaz ptsgyinehelyezhet el02szilrdtrszintsszes nvlegesc10350 maz brnjratgstermkelvezetnhegesztsi felelsselzemi nyomsaelltottkivezetsre vonatkozkszlk fellltsiprsidomosaz elrasztsi znaterletilegplet homlokzatnegymshoz elgsgesenfelsznimegfelelsgkiviteltlkszlk levegalakjt a terveznekc15terletileg illetkes fldgzelosztmegfelel mrtk tlnyomstartozkainakhegesztett ktsselemberi tartzkodsra szolglhelyisgnekkszlk gstermktnyomsszablyoz51vagy ezekkelaz otszkell felszerelnibiztonsgi szablyzatpontjbanfggetlenbtor esetbennaplnak tartalmazniartke nevalamint121es zntmegfelelsgetigazolsakisebbpadlszint alattesetben azbiztostlgtrkdkkell lennie sha a szellzs a tervezkell megtervezni hogyvillamos hlzativarratokgstermk elvezetfels szintjecm2 szabadvonatkoz kvetelmnyekhziszlnyoms szempontjblelltott vagyfellltsi helyisgbehelytgz nyomsnak szablyozsraeselfordulsaalattikszreszellznylsa152871 gstermkelvezet berendezsekramlstechnikai mretezsi eljrskszenltihelyzet hatsai ellenifggleges vagyszemrevtelezsselkivitelbenmdoncsatlakozvezetk a felhasznliptsggyel sszefgg szakmagyakorlsivarratok szemrevtelezses ellenrzsnekkszre szereltegy helyisgben legfeljebbgzfogyaszt kszlkhezteljestmny membrnos lemezhzashatrolgznyomsszablyoz llomsontrbe kivezetettnekfelsrendelkezsre lls mrettgster tzelberendezsekhelyezs elttieredmnytazonostb brkgzellthogy azstpbiztonsgi elrsokatvgngyrtja ltal elrtnagyobbfellvizsglt sgzkzegbrneredmnyez melynektartalmazzkamelyben tlnyomsipari gznyomsszablyozvillamoshibracsatlakozhuzalhl vagyllandazzal egyenrtk mselhelyezse nemmszaki biztonsgi szablyzatjratban kell elhelyezniszakgielprologtatramlsis mkds szempontjblget 3kzs gstermkelvezetblipari gznyomsszablyoz llomsttermszetes tztrhuzatvezetilegalbbazoneltti ventiltorral elltottaz pleten bellgstermkelvezetkialaktani hogylehettervezsereteszelnitblzat szerintigstermkelvezet szabadbarobbankpes gzkzegmeg a tervezsinemvanhomlokzaton kellrztvzetekszakaszban tlnyomskialaktsrahelyisg falnlgznyomsszablyoz sanyagvgztvolsgban helyezhetkhuzat elvnrintszerinti smnak megfelelnemzeti szabvnylegalbb 5biztonsgigyorszr steleptsegstermkelvezet gyrtjaszerelvnynekmegoldsokat gyszerinti smnakszakaszaiban a gzfogyasztegy termszetesvdcsbellimretezslegalbb egyenrtk mszakitztr eltti ventiltortlgternez azfellettelgzelosztmrtk tlnyoms elfordulsavezetk a telephelyigzmr nemnincseutpusvizsglatihasznltleveg beszvsra szolgltvzetlengz csatlakozvezetkekmsgzfogyaszt kszlkek elhelyezsnekhelyezs elttamennyibenjegyzknyvbengznyomsszablyoz llomsnincsenek olyan rszeinagyobb egyttes hterhelsesetn a kivitelipontban foglaltakminiszteritervtlhuzatvdelmib32ne jelentsenhegesztsi varratokfigyelembelgtern tvezetkapcsolatos sajtossszekttetsbentlnyomsoktervezettlegkisebbterveziaeroszolok levegvelhelyisgeknyomsnak szablyozsralv helyisgekben teleptendkivitelezsevlasztaninvleges zemijelentsengzfogyaszt kszlk gyrtjnakigazolmunkt vgzakns kiviteltartzkodsra szolgl skpestsselbellnyltghetlemezhzashasznlt jrat1 rszszellzcsfogyaszti vezetk nyomvonalnakgyrtmnyokvezetk rejtettterveztrbe22forgalombamsz en 133841megnevezst azonostfelelsszabvnybanszablyozsrakzs rendszer gstermkelvezethztmenetitanstott saz en 1749kzvetlenlkzs rendszertmrsggznyomsszablyoz lloms esetbenipari skvetelmnyei snyomvonalnakvarratok szemrevtelezsespletbenkell alkalmazniolyan gzfogyasztrz smegfelelnekhogy a kikapcsolthelyzet hatsailtestmnyekfggetlenl forgalombavagy egyttmkdaz arhbrk szerintgyrtltestmnyszerelsi nyilatkozatalapjn kellfm anyagkell elhelyezni smrtk tlnyomshegesztsi tevkenysgtpus centrc7 c9ne legyenhelyisgben legfeljebbutni ventiltorral elltottmegakadlyozzktmrsgi prbafbbaz ptsggyel sszefgglegkzelebbinlklnem lehet nagyobbll robbankpesfellvizsgltzemelstgzfogyaszt kszlk gyrtjalehetvcsatlakozssalideiglenesen7 b vagyrendszerekreelrendezsnek megfelelenakkor a gzfogyasztegyszerstett kszlkcserefeltteleittartozkoktrtntabban az esetbenkialakulsaszolgltat telephelyi szolgltatszabvny vagy azzalidertvetevkenysgjogimellkelttelepthetgstermkelvezetblvezetk nemmbaraz egyb brk felsnagyobb mintmagassgtidom anyagminsgtegy eloszt rendszerszervezetfellltsi helyisg lgterbenlevegtcsatlakozvezetkben mszakiaz azzal lgtrsszekttetsbeneloszt rendszer levegbevezettelhelyezsre szolgl helyisggstermk kivezetsnek11 ckszltsajtos kvetelmnyektervezsvdtvolsgon bellbrk felskszlkek elhelyezsnekgzfogyaszt kszlkhez mellkeltengedlyesgstermk elvezetse tbbb1 tpusb vagykell hogy azlevegvel alkotott keverkblmrtk tlnyomsok kzlvezetk pletenrejtettelrsaigzfogyaszt kszlk rszeknthogy a kszlkbiztonsgi szempontbltpus gzfogyasztc33nagyobb gzmrkszlkeknlelfordulsa megengedettvezetkes pbgz szolgltatb52 b53nbsptpus gzfogyasztegyikeptszetibra fels brarsznekb41helyszni irnytsvalaz pletbenem ghetzr szerelvnyszablyairl2 dbegysghterhelsamelynek tbbrendszerek biztonsgi kvetelmnyeic5 c7rendszer gstermkelvezethzhuzamos emberi tartzkodsrahosszakisebb rtknekltestsnekrsban megbzottvezetk trszint alattitevkenysgekrl szlnyomsfokozszerkezetileg s mkdsfelletszabvny szerintigstermknek elvezetsrelthatrendszer gstermketj hegesztsiszereltszemlygzfogyaszt kszlk sszolgl sc63c33akadlyokce megfelelsgi jellsselelzr szerelvnyt kellfelc13 tpusmrsis a hegesztsirnytgstermk kivezetazonostottha a levegbevezetcsatlakoz gzfogyaszttmrsgvizsglatkell szerelnimmnlmrhelyisgetcsatlakozvezetkbenvagy azhozaganyagsszefgg szakmagyakorlsi tevkenysgekrlmszaki kvetelmnyekkeltt20hatsa alattgzfogyaszt kszlkek esetnlv helyisgekbentechnolgiai rendszerts biztonsgivezetkenkszlkcsere kivtelvelrszletes szablyairl szltelephelyi szolgltat vagyc5esetn a szerelsis a gzfelhasznlmszaki megoldsokatgstermkelvezethz kell csatlakozatninyomsszablyoz lloms gpszetiellenrizni kellznbaaz gstermkelvezethzlegfeljebb 140gstermkelvezethz nemramlsbiztosttztrprimer53 a vagy19fels brarszekivitelnekkszlk csak olyanmegvalsulsi dokumentcitervezse kivitelezseki kellvagy kzpontib14 b22lvszltltpusnak1749 vagyki kell vgnigsterismteltrintsvdelmib11technolgiai rendszerterveznek biztostania kellvgzk smrhelyisghelyezkednekhelynlgtrsszekttetsben lvflttmintfogyaszti vezetketnylsainak elhelyezsegzfogyaszt kszlk nemutniteleptendvezetk zemivezetni50elememunktgzmrtbrk fels brarszelgnyomsolyan gstermkelvezethz csatlakoztathatktpus centr 1749anyagminsgtmindencsatlakozik a gzfogyasztelhelyezni hogymopfigyelembevtelvelelrendezsicsatlakoziks zembeersramfellltsi helyisgnek140 kwhegesztsirnytbelli hatrolsmnakmeghaladpletbe trtnazonos helyisgbenmelydbaeroszolok levegvel alkotottrintettsge esetngmbszlevegbevezetkntmechanikaikivezetstzrt trtpusokgz ramlsilegalbb egyenrtkvillamos berendezsekrszeszerint kellkrosgzfogyaszt kszlknekgznyomsszablyzamelyeketelleni vdelemvalamelyikvelelrsainakkivezetgsiplet klspbgz elltsban alkalmazottkszlkhez a fellltsihasadnylsszegzfogyaszt kszlk zembegztzhelytanstvnyacljblpontjban ekkntc7 c9 c11rendszerek biztonsgikilpsrekivitel gznyomsszablyozkszlketszmtssal kellmretarnybanvagy kdk aeroszolokez a gzfogyaszttelepts sorn vltoztathats nyomsviszonyokbiztonsgosegyikelrendezs gstermk kilpsremegfelel azs telephelyib22 tpusminsljenek ezhuzat elvn mkdgzfogyaszt kszlk helyisgbekeletkez1az zembe helyezvarraton vgzett53vgz gzszerelmszszellznylsteljestmnynlpincepadlszintszabadzembe helyezszabadbangzfogyaszt kszlk gstermktolyan rszeimegbzottjaazonost sorszmtgstermkelvezet egyfelhasznltgstermknek elvezetsre szolglaz elzrtervben elrtptsic5 c7 c9vdtvolsgt a terveznmkdenbeptenimeghatrozniezzel egyenrtksma szerintlgelltsftsib44sorn biztostanijogosultvagy idomjellsselingatlankivezetettnek minsljenekmrtkbenmegoldsokats ramlstanipontjban meghatrozott gzfogyasztcsatlakozvezetk fogyasztiegy vagybevezetsgyrtja ltalaclcsmegfelelnek e pontadataitc33 tpusmrtk tlnyomsokvegyihegesztstgzfogyaszt kszlk teleptsreegy vagy tbbkszlk biztonsgoshelyentvolsgbantervbengstermkelvezetregzfogyaszt kszlk szabadbagstermk kivezetstzemel gzfogyaszt kszlkenb44 b52 b53nbsptpuskoncentrikus akkor ezeketmegengedett azrszt kpezze amelyterveznek meg kellbeszvsra szolgl nylsaitlegalbb a kvetkezfeltteleksorn vltoztathatbiztonsgi lefvat szellznylsaszellz levegtlnyoms alakulhatrelatvszerelsfggleges vagy vzszintespe anyagilletkes gziparilevegt egyhatrozzakibocstsitmegramrszeitalakulhattlnyoms alattvaltztr utn elhelyezkedmaz llomshterhelsevagy ezzel egyenrtkmszaki elrsokkikapcsolt kszenlti llapotgstermknek kivezetsretechnolgiai rendszerekeltti ventiltorralfels brarsznekmeg aztzelstechnikais gstermktms mszaki elrsm3hb1pleten bellikmnysepripari05beptsrekszlk fggleges elrendezsegyenrtk mszaki megoldsokatpontban meghatrozottnyomsnakaz gstermkelvezet szabadbanem zrhatvvelevegelltbiztostotthtgulsiidomokgyrtmvis a levegbevezetegy korbban gstermkelvezetkntegytthegesztkllandsulthozzfrhettrgyaks gstermk kilpsreakkorlegyengzfogyaszt kszlk esetnelrsai alapjnmdostsazemeltetettkszlkaamely azlegfeljebb 15kszlkek amelyeknekltal megengedettb23 b32 b33vezetkhezkivitelezettszerintvezetkbens az gstermkelvezetkszlk esetben azmegfelelbeszablyozsitrbe kivezetettnek minsljenekgzfogyaszt kszlk gstermkelvezethzmrett s alakjtjlfelhasznli berendezs sfalrazembe hadtvolsgban helyezhetk elfeltntetettltalnos kvetelmnyekcskkentett teljestmnnyelszakmagyakorlsihrekszenlti llapotgzfelhasznl technolgiai rendszerthelyisgeibe vagy mshelyisg lgterben csatlakozeljrsgstermkelvezet egy olyan3 37gstermkelvezet berendezsek tervezsekvetelmnyei 8211szabadbakell venniszabvnypletnektelephelyi vezetkethelyisgbe vagy mshterhels gzfogyasztlloms zembekszlk azlefvat szellznylsa kivezetsnlaz ipari gznyomsszablyoztevkenysgnekarhazt az rtketmszakibiztonsgi szempontbllersbanvezetk sgzkoncentrci rzkel sellenrzsnek eredmnytrtkaz 53dugshegesztgzelltsaholgyjtfeleljenek megszellzsszilrdsgi selprologtat berendezsgzfogyaszt kszlkres gstermknekfldgzszerintihtrnyosanszabvny szerint152872 gstermkteleptsre vonatkoztechnolgiaid bras azzal vezrelttpus ramlsbiztosttrsznekfogyaszti vezetk sellenllnakelltott ramlsbiztosttgstermkelvezet minstseghet gzakns kivitel iparitgzinfrastruktrabra alapjnnyomvonalttervez ltal meghatrozottkiramlkell megvlasztanimegfelel smas tmrsgi24alkalmasnak minstettcsatlakozvezetknekezeket a nylsokatkeltt sarh 40ptsgyi sadelhelyezkedskmszakibiztonsgi szempontbl trtnszolgl kivezetserendszer rszevizsglatigzfogyaszt kszlket kiszolglc12nagyobb relatvkln mrhelyisgkivitelezjnek rendelkeznieoldhatgyjt vagyiparitmrsgialkalmazsaigazoltnagyobb relatv srsgvltoztathatvezet rszeivellegnagyobbolyan gstermkelvezethzmrtktazt azvetletbenelhelyezsefeketezemeltetsiszelepaz aknaelemekblbeelhelyezsreesetn azhelyisgbens rztvzetekgzfogyaszt kszlk gstermknektztr elttvagy azzal legalbbcstmrgstermkelvezet tbb gzfogyasztnagyobb stvolsgalevegvel alkotottfelhasznli berendezsekalkalmasnak minstett kiviteliaz egyszerstett kszlkcsereamelynekhasznlaton kvleufalnmnlb bra szerintib33az azzalegy elosztvagy kzponti rendszer60079101vdtvolsgtmezgazdasgikemnys telephelyi vezetkelrsainak vagyrsztd vagytzelanyaggalgzfogyaszt kszlk azvdcsbepletszerkezeti jratbanehhezllapot vagyeljrssalhelyezett152872 gstermk elvezetaz a tpusel hael kell vgezniszablyozott oldalielrtaktr illetve padlszintazalakulhat kikszlk esetn aztpus egy helyisgbenrsz nyitott gstercombustionc1szabadblvarraton vgzett javtsoknem haladhatja meggstermkt elvezetptsggyel152871szmtssalfellltsi helyisgeibenyomvonalt gy kelltzelberendezsek gstermkelvezetaz gsi levegt34leveg beszvsra skzlekedsielhelyezni skell csatlakoztatni azvezetk megnevezst azonostprbnakkszlk fellltsi helyisgbene veszlyeztesseaz elzr szerelvnyszabadba nyl vgnhogy azok eegy termszetes huzatkzvetlenl vagyhogy a kiramlzemel gzfogyaszt20200417vissza a tartalomjegyzkhezgondoskodniknnyenlehetsgtelvezetsnekktsekvezet tereit hatrolgstermkelvezet berendezsek gstermkelvezetfggetlenls a telephelyiterletikeverkbl ll robbankpescsatlakoztathatk amelynaplnakaz gstermk kivezetst gstermkegyedilegteleptetteumegfelelsgimelyekvezetk megnevezstventiltorlgtrsszekttetsben lv helyisgekbenramlsbiztostt nemtelephelyi szolgltat telephelyic tpus gzfogyasztegy kzstbb gzfogyaszt kszlkhogy a kzss fogyasztiaz automatikus zrgstermkelvezet berendezseirendszerekre vonatkozidegen6007914hegesztsrenem llkorrzirsbaneltt elhelyezked ventiltorralennekmegtervezni hogykivitelezett csatlakozvezetkanyagokszl rendelethelyisgeibe vagylehet nagyobbnyomsviszonyok hatsatereitgstermk az08helyisgben legfeljebb 140szekunderberendezstkell lennie44beszvsra ssszefgg szakmagyakorlsikapualjbanszerinti smk egyiknekkivezetsre szolglerrerendszer fgglegescsvezetkekvgzkelhelyezkedsezembe helyezsszellznylsa kivezetsnlgyrtielltsban alkalmazottgy hogyvagy jogibrarsznek megfelel smkelhelyezsnek ltalnosszablyozottcmtkszlken tb14 tpus gzfogyasztberendezsei szabvnynlllomst gy kellvagy rcsel kellceanyag vezetkekfld alattijratban kellcsatlakozvezetket fogyaszti vezetkettelephelyi engedlyesesetbenrszeknt forgalomba hozottkszlk oldalelemnektervez ltal kivlasztottidpontjbanelrsok szerint05 mnorml zemiszakmagyakorlsi tevkenysgekrlmrtzemhezbrk alsfordulhatramlsbiztosttelhelyezett gzfogyasztb2korbbangstermkelvezetbl gstermkkivezetst gyhomlokzati kivezetssel rendelkezbell csakipari htechnikai berendezsekvonatkoz specilis elrsokagzfogyaszt kszlk fellltsiszabvny vagyszerkezetileg1400 kw08 mzemt nemlevegelltsszolgl nylsaitbizonylatonlegalbb 50vagy a homlokzatonszl miniszterielhelyezsnlgznyomsszablyoz llomsttanstottszolgl helyisgmegfelel mrtkhibacsatlakozvezetk a fogyasztigztrolkkszlk gstermknektrgybeszvsra s gstermkhelyezkedjen elrendelkezsrecsakvzszintes vagyberendezsek h skzpontib32 b33osztlyfggleges pletszerkezeti jratbankivezetst a tetterleti fldgzelosztkarbantartsifeltteleknek megfelelszellzbezrhatbrarsznek megfelellefvat vezetkvezet tereitmeghatrozott gzfogyaszt kszlkmegfelel megoldsokat gygpi elszvgstermk tmegramszerelt gzfogyasztkzlszolgltatvizsglatgsi leveg beszvsraaz pletbenkttpus gzfogyaszt kszlkjegyzknyvipari gznyomsszablyoz llomsirnytsvalbiztonsgi szempontbl egyenrtknem huzamosgzfogyaszt kszlken thatsahelyezse 1 rszkzsterhelsi llapotbanszempontbl egyenrtkvezetkszakaszbateljestmny membrnosh s ramlstanikzpnyoms hzigzfogyaszt kszlkennyithatkivezetsnekznt eredmnyezelvnberendezsek 2 rszbe s kivezetsre27aclcsvekc11 c13sfldgzelosztmegnevezst cs9keresztmetszete133841 gstermkelvezetkivezetssel rendelkezvezetkesmszakibiztonsgivdelmetelhelyezettvillmvdelmitrben3 37 pontjbanszabadtribszlnyomselvezetsvelkell tekintenimegfelel smk egyikecsatlakoztathatkvezetkes pbgz25nl nagyobbcsvezetkberendezsek gstermkelvezet berendezsekpletekpletszerkezeti jratban helyezkedjenbeavatkoz kszlkkel selemekszksggstermkelvezethz csatlakoztathatk amelylemezhzas gzmr132 rsz zrtfldgzeloszt vezetkes pbgzgzfogyaszt kszlkkelzrkszlket a fellltsigstermk kivezetsre szolgltlnyoms alakulhat kihasznlatine befolysolja htrnyosankvetelmnyekfeltteleknekfldbehelyezhet zembe ha5kell vgnikszlk fellltsi helyisgbentervezhetielgsgesen kzelmeghaladjaamelyen a gznyomsszablyozorszgktstsornkszlka termszetes huzatkszlkek gstermkgznyomsszablyoz llomsnakelttikszlka tztr utnisngelrendezsben kell teleptenivisszakilpsre szolgl kivezetseelhelyezsre akkormegfelelsgtfeljogostottgzfogyaszt kszlk teleptsebiztonsgi lefvatfellltsi helyisgenhelyisgen tvezet gstermketc6jelztblvalamellyelkellzemenkialakul tlnyomselleni vdelmetvzkszlkcserellomsaz egyedikivitel ipari gznyomsszablyozcsatlakozzonelkzs gyjtmegvalsulsikapcsoltlnyoms elfordulsa megengedetthelyrajzikell ltesteninyitott vagyszemrevtelezsesnylmegvalsulttbb gzfogyasztgsi levegsszeszemi szellztetszerelsearszeinekjel18kpesartkevdenielrasztsi znac3hlzati csatlakozssalaz pletenbiztostsvalolajgkaz gstermkelvezet egyttestszablyairl szlkszlknekcsatlakozvezetk felhasznli berendezsaz ilyenegyttesenipari htechnikairobbankpeskiviteltl fggen vzszintesamely olyans beavatkozaz zembes gstermkkszlkcsere esetncsvezetketcsidomlgelltsihatsai elleniszabadba vezettartalmaz gzfogyaszt kszlkagstermk elvezet berendezsekadjahelyisgekbenmeg aztgzfogyaszt kszlkzrt gsteraz gstermkelvezet minstsepbgz zemrobbans elleniktelesbeptsre vonatkozgzfogyaszt kszlk gstermklgterben egyb5 tpusgzfelhasznlelrsnaksszektszabvnynakfelhasznlicsak abbansikereskszlkbefggleges elrendezsben kellterveznek biztostaniamszert37 pontjban meghatrozottpletbekros hhatsvagy az mszkell teleptenimaximlisrszeknt forgalombamembrnos lemezhzas gzmrramoljon a gzfogyasztkiltal megengedett mrtkzsalu huzalhl vagymreteznib42hegesztsi tevkenysg helyszninyomsprbtaz pletazzal vezreltrtknek megfelel mrtk55vdelemtetgerinckell lennie azmegvlasztani hogykivezetettnek minsljenek ezmechanikai smeg nemvalamint a hegesztsikiviteliegszsggyikezelhetteleptsre vonatkoz specilisalkotottaz gstermkkiviteli tervnorml zembenpbgz forgalmazaz gstermkelvezet gyrtjatovbbigztrolfolyamatostztr utnaz iparimegengedettelvezetsre szolglszabadbl nylautomatikus zr szerelvnytet felettegyttestc vagyhatrnlc3 c5 c7prbatmrsgi prbnakb bra alss beavatkoz kszlkkeltztr utnikiviteleznyitott gsterktttreteszeltalgyrtja ltal megengedettgznyomsszablyoz gzmrplettrszint felettmeg nem halads azzalgpszeti berendezseketzemterveznek kellkszlk esetnbiztostania kell hogynyl vgnfolykonykialaktsgznyomsszablyozk sleveg beegyike szerintautomatikusrzkel steleptsreazokelrendezs gstermkteleptett gzfogyaszthelyezstlnyomsok kzlb53nbsptpus gzfogyaszt kszlktzelanyaggal zemelteleptsnek tervezsekszlkkel s azzalnincsenek olyankszlk fellltsi helyisgnekb5 tpus gzfogyasztegymshoz elgsgesen kzelm3h nvlegesmszaki kvetelmnyek szabvnyez nemekkntacl anyaghelyszniidtartamanormlelhelyezsfigyelemmelvezetk trszinteztberendezsek tervezsersz zrt gstergsi levegtrgztenielrsaitmrhzi gznyomsszablyozktpus gzfogyaszt kszlkek32020 i 13levegt a fellltsicskkentett teljestmnnyel zemelkondenztumkszlkrefldgzeloszt vezetkeskivitelezst vgzszerelt llapotbanmszaki biztonsgi szempontblkivitelezstengedlyes vagyfogyaszti vezetk rejtettel amely egybra szerinti smkmegfelelsgitalajszint flttroncsolsmentesfalizemeltetshezpletenszerelvnyekelvn mkd gzfogyasztse1400 kw egyttesszabadba nylteljestmnynl nagyobbvltoztathat tvolsgban140 kwnlhlzativezetkszakaszkzismk egyiknekkszlkhez mellkeltvzszintes vetletbenvizsgltmindamelyeknekegy olyanalapanyag megnevezst csalkalmazottramlstanipbgzc tpusazonos lgnyomselhelyezsilgnyoms trbe kivezetettnekfelsoroltmretezettgstermkelvezet berendezsei szabvnynyomshatronnylszrbrarsznekkivitelezjnekkiraml gstermk azelrtnmkdfeltteleinekcsatlakozvezetkorszgosgyc63kivezetst gy kellhelyezkedjens gznyomsszablyozgstermkelvezet berendezseinekvarrat nlklihelyalkalmazhategyttes hterhelsmretrtkrebrarszeaz egyedi gznyomsszablyozkiegsztmkdlegfeljebbegyttes hterhels gzfogyasztamely egyazzal lgtrsszekttetsbenleveg bevezets56tpus gzfogyaszt kszlkakeletkez kondenztum133841 gstermkelvezet berendezsekaz elshelyisg lgternlennienyitott gster tzelberendezsekgstermk elvezetsearnya3701kzpnyomsszolgl helyisgben sltal kiadottvonatkozeltti ventiltort tartalmazb3 tpustekintendmennyisgc62c102berendezseiszellztetb12 b13fogyaszti vezetk telephelyikikapcsoltvillamos berendezskell csatlakozatnib52esetlegesgzfogyaszt kszlk tpusazzal vezrelt vszszellztets egyedikivezetettnekhegesztsi felelssel valamintmegbzottviivzszintes vagy fgglegeshelyisg lgterben egykszlkhezbrkvezet nylsainak elhelyezsekszlk zemvelkzponti rendszer gstermkelvezetbladatokatgstermkelvezetn keresztlmegengedett mrtk tlnyomsoknagykzpnyomslegnagyobb zemi nyomsb53nbsptpuselrsainak vagy ezzelkell kialaktani hogymegoldsokat gy kellalkalmazott mszakigstermkmagassgbancsatlakoztathatk amely olyanrendszer rszt kpezzegstermkelvezet szabadba vezetkell a gzfogyasztalapjnnylsait25 barel a gzfogyasztkszlktl1estelephelyi vezetk nyomvonaltsorn biztostani kellgyermekek tanulkskjafajlagoskivitelezspletgpszetiegyiknek megfelel elrendezsbenbefolysoljaterleti fldgzeloszt telephelyitztrrelutn elhelyezkedllapotban idertveforrsainakmajdb tpus gzfogyasztbarfogyaszti vezetkbetlnyomstanstvnynaknvlegesegyenrtk mskell megvlasztani hogykszlkek gstermknekkzttic12 tpusfellltsi helyisgblzemi nyomsnem huzamos emberikszlken t gstermkcsatlakozvezetkensrsg gzgstermkelvezettlakossgikapcsoldmm cstmrkpezze amelynem tartalmazemretezsiszervezet amelykw egyttes hterhelsgzfelhasznl technolgiaielvgzettvgni s azdokumentcigstermkelvezethz csatlakozftsthegesztberendezstrsgszintetikusgyrtjnakbtors a kszlkb22 b23 b32gzfogyaszt kszlk csakkell vezetni1749 szabvnybanbementerveznekcrszhezegszsggyi sezzel egyenrtk mselhelyezsnek sajtoshegeszts kivitelezjnek rendelkeznietztrhuzatjelenramlstechnikaiel nem zrhatc6nbsptpusazzal egyenrtkotsz szerintifggentervneksmk egyiknek megfeleltpus gzfogyaszt kszlketjratban helyezkedjentervezhetszerkezetekaz gstermk elvezetsekoncentrikusrobbansveszlyesvezetkek biztonsgimegfelelenrendelkeznieellenventiltorral rendelkezeloszttervezsikz46rsznhasadvagy egybelzrtrcs13 itmbeptsnekolyangstermkelvezet berendezsekelltott ramlsbiztostt nemhelyisg lgterbenhogy azoktekinteni hogyrendelkeznie kell hegesztsimrettlgtrsszekttetsbenamelyeknek nincsenekzemvelha aztkiviteli tervbenmellettkellanbspaegyminsgszs az gstermkj gzfogyasztptsgyikszlk teleptsreeltt elhelyezkedkszlkkel s33hegeszt nevt azonostlgelltsttervetelrendezsvzszintesgzzalvizsglatttervezse sornelrendezsbenvezreltjogosultsggalkzponti rendszervdelemmel kellvezetknekhozotts az azzalgzfogyaszt kszlk oldalelemnekelektromoskedveztlenhatsailtestettnyomsszablyoz llomsaz esetbenvagyhegesztshaladja meg azts egyedi gznyomsszablyozellenrzsnekktfokozat25berendezsek tervezse kivitelezseaknavagy azzalfelelsselkivezetsrecsatlakozatnikockzatikrkapcsolatbanzemen kvlmsz en 152871s kivezetsrefellltsi helyisg lgternkzmvekeurpaiszivattyvezetszempontjblkszlk gstermkelltsban alkalmazott mszakims mszaki megolds53 bb11 b12nyilatkozatotfolyadkfzisnyomscskkensttevkenysg helysznimszaki megoldsokat gyidom anyagminsgt srszreaz idszakosszksgesgyrtjasemminimlisidszakoselzr szerelvnyekteleptenivisszarszekntkell terveznilgterbenrtkneklegalbb 10trihelyisgen tvezetpletskonrendeletb52 b53nbsptpusfokozatazonos pletskonszemrevtelezses ellenrzsnekforrsokgstermkelvezethz kellkszlkkel azonosszmeg8krnyezetikvntkiviteli tervnekszolgltat vagykitorkollstgzoks egybmsz en isokszlka termszetes tztrhuzatprbnak kellszintjnmszerrelnevt azonostteleptenitekintenis karbantartsiarh 20vennieszkzbar zemicljrafldbe sllyesztettazok e ponthhats elleniszellztetsszabadba kellgzszivrgstzelamelybenramlsbiztostvaloldalivezetk nyomvonalnakgstermkelvezetbeelvn mkdfogyaszti vezetkentartlygzfogyaszt kszlkatpus termszetes huzatpletek szerkezetekkivitel ipariminslkell rgzteniaz ingatlannylsokat gy kelld bra szerintialkalmazott hegesztsivagy a cskkentetthelyisgben lvvezet nylsainakelemeifljelentsen veszlytmszaki elrsmkdshez szksgesgzfogyaszt kszlkek amelyeknekcs vagy idomaz olyanrszeikifejezettenha azb1 tpus gzfogyaszthegesztst vgzkveszlyeztetilletverendelkezikkell hegesztsi felelsseltztr eltti ventiltorralhajlkony vezetkelfordulsa megengedett azszempontbl kifogstalankpesgzkszlkkiszolglaz gstermkelvezetbencentr 1749 vagyltalvarrat azonost sorszmtkpezze amely egyb11 b12 b13kivitelkell megterveznijeltksztcsatlakozssal rendelkezgpimsz en 12279kpestkwnlpletszerkezeti jratban kellkialaktsa szerinttbbkivlasztottvagy fogyasztitet fltt kellrvnyeskzs gyjt vagyvezetk s telephelyihegeszt tanstvnynakgstermkelvezet berendezsei szabvnynaknylsokatnylszrielzetesenhtechnikai berendezsek 2c3 c5az arh 20befolysolja htrnyosanhaladjakialaktstl fggenrtket amelyettvezetettjavtsokbrmely terhelsivezetkgstermktkezelnirtke ne haladjawm3pletben elhelyezettlt moplennie azs fogyaszti vezetkelvezet berendezsekilletve padlszint100 mbarazonosha a helyisg30fels brarsze szerintikell elltniezekkelkell vlasztaninlklimegfelelnek emszaki biztonsgi elrsokatnyomsviszonyokfalberendezsek 2termszetes tztrhuzat elvnazokkalvonatkoz mszakihaladspecilis elrsokallapotbanelhelyezse nem koncentrikustermszetes huzat elvnnylsok elhelyezsekszlkek helyisgnekb14get 3 37llomsonmreteklegyenekaz gstermketelhelyezked ventiltorralmiatttpusszellzstfltt kell elhelyeznihterhels gzfogyaszt kszlkekaz gstermk elvezetsszerelsib32 b33 b44utn elhelyezked ventiltorralhatsokkzl a kisebbbiztonsggalegy fgglegesmkdscsatlakozssal rendelkez gzfogyasztaz esetben haeltrszakaszban tlnyoms kialakulsaszabvnynak megfelelfoglaltak alapjn kellteljestmnnyel zemelolyan rszegysgeketfellltsi helyisgbe vagymegfogsirendszer gstermkelvezetblbra alszrjonpontjban meghatrozottelvezetsvel kapcsolatosmegjegyzknyvetteljestmnynl nagyobb gzmrznt eredmnyez melynekgsi sszolgl helyisgeks gstermknek kivezetsreidomszerelvnyeketegymshoznyilatkozatane haladjakikapcsolt kszenltigznyomsjratbankzltbelertvemegfelelnek kellelgsgesenminstsaz j hegesztsiptettvgzett javtsokaz elprologtatrszt kpezzekiraml gstermkgzfogyaszt kszlkek helyisgnekhtechnikai berendezsekgzfogyaszt kszlket azhasznlataz e12279 gzellt rendszerekb12gznyomsszablyoz lloms gpszetinemzetigzfogyaszt kszlk brmelyalkalmasnakeloszt rendszervgezhetirsz zrtfelhasznli berendezsek sszellztet levegs annakrendszer gstermkelvezetfldgzeloszt a vezetkess az jszolgltat a telephelyigzfogyaszt kszlktlutni ventiltortals lemembrnosnem megengedettrendelkez gzfogyasztsmnak megfelel elrendezsbenelltsbanveszlyeztessemellkletazok megfelelnekamelyrendszerek gznyomsszablyozkkoncentrikus akkorgzfogyaszt kszlk zemveloldalelemnek magassgtne jelentsen veszlytkszlk helyisgbeelzrgznylsnakszemrevtelezses ellenrzsnek eredmnytlevegbevezett is tartalmazszabvny elrsainak vagytartalmazzatpust skszlkekalkotott keverkbl llmeghatrozniaegymstlc6239elhelyezkedkszlkmoduljanem koncentrikus akkorelvezet berendezsek gstermkelvezetllapottmnl kisebbkln mrhelyisgetvarratonelrt szerelsinem haladhatja140 kw egyttesnyerigzfogyaszt kszlk esetbenkorrzivdelemhelyezkedjen el amelyteretmeghatrozott gzfogyasztgzfogyaszt kszlket egygstermkelvezet tbbvizsglatnakengedllyeltartozszlfelhasznlnakmreteit16 bar57smkvizsglat sornlefvatgzfogyaszt kszlkek gstermknekkpezrzkelb brk alskvetelmnyeketvagy ms helyisgekbeaz mszfggen vzszintes vagymretnekventiltorral elltotte pont kvetelmnyeineknvleges teljestmnyrtknlbeszvsraa1beszv smescsatlakozvezetketteljestik e pont11gyjt vagy kzpontigyrt ltal megadottelhelyezsre szolglrendszer gstermket vezettevkenysgekrlkiviteli tervtlamelyeknek nincsenek olyancserjtgzellt rendszerek gznyomsszablyozkgyrtja segyescsak akkorgzfogyaszt kszlka termszetesptsggyel sszefggbiztostani kell hogytekinteni hogy az53 b brkalakjthlzati csatlakozssal rendelkezszakgi mszaki elrsokkell beptenimegfelelsgi jellsselhelyezhet zembemkd gyjt rendszerkszlk szabadba vezetbetartsval kellfellltsifelttelekkelcserjevezetketrszegysgeketazok megfelelnek eaz automatikuslloms gpszetikockzatottrfogatramals brarsznekkijelltfeladatab22 tpus gzfogyaszt152872llomst gyrvidpbgz szolgltatc11 tpus gzfogyasztkvetkezhkszlket azhuzalhlgzfogyaszt kszlk konstrukcisadotttvezetegymshoz kpestmeghatrozottakllapot47lennievissza a tartalomjegyzkhezkeresztllegalbb 1gyrt ltalelrsaelhelyezvenyomsklnbsgrszei amelyek32foglaltakjelziaidtllhivatkozssal forgalomba hozottnylsaikivitelezsre alkalmasnak minstettkwnl nagyobbgzfogyaszt kszlkek fellltsiberendezsek gstermkelvezetkszlk fellltsi helyisgblcsak olyantpustpleten kvlfigyelembevtelvel kellkialakthatkilpsre szolglkszlk elzrkrnyezetbenfogyaszti felzrgy kellfeleljen megrendszer gstermkelvezethz amelybentanulkhelyezsrehelyezhet el haegyetlenblokkrendszerbiztostania kellakkor helyezhetkibocstamely egy elosztkell betartani21kszlk gstermkt vezetkorltozottkszlkek fellltsi helyisgeibeszolgl nylsait tartalmazzemelsre20200417visszavagy kdkkivitelezsreszomszdos pletekalbbims helyisgekbeaclvdelmt biztostani kellfelhasznli berendezshomlokzatizemelkell vgni samely olyan rszegysgeketelvezet szakaszaibanelrendezsben kellszakasztkszlk sveszlyt azbizonylatilletkteleneknyomvonalt gygzmrvdtvolsgonkiviteli tervetszabadban kellfelett vagytet flttgzfogyaszt kszlka tztrlloms esetbenhelyisgben s az2es znbaszolgl helyisgbenterhelsi llapotban idertveabban azlevegbevezetkls hatrolzrt gster tzelberendezsekgznyomsszablyozgzellt rendszerekgzfogyaszt kszlk teleptsnekkzegekegyttmkdelhelyezett gznyomsszablyozszerelvnythatlya alattlljonirnyt4kszlk olyanszerinti smk05 mnlipari gznyomsszablyoz llomsoncs vagyfelettdepresszi12279 gzelltkeverkblnlkli gzfogyasztoldalngstermkelvezetbenlevegbevezet sgetbeptettvonatkoz specilismmbrmely terhelsi llapotbangzipari engedlyesrendszertvagy vzszintescsak olyan gstermkelvezethzberendezs s telephelyimkds szempontjblfelszerelnigstermkettartalmazaz gstermkelvezet egyc13 c14s azkivezetsebrarsze szerinti smkvezrelt vszszellztetcsatlakozvezetk fogyaszti vezetkllomsnakfolykony tzelanyaggalkialaktsateljestmnyzrtgstermkelvezet gyrtja ltalkell vgeznikorrzivdelemmelkszlkek esetnnyitsihatsa alatt lllgterben csatlakoz40kzelbeszvalattberendezs sghet anyagkvetelmnyeineklevegt vezetkizrlagfggleges elrendezs gstermkpontnllaz zemikell teleptenivisszakszlkhez mellkelt dokumentcijbancsak azhuzamos emberiaz elrtgy kell tekintenivagy vzszintes elrendezsfeszltsgnvleges teljestmnynl nagyobbnylszrkelzr szerelvnygzkoncentrci rzkeltanstvnya szerintib53nbsptpus gzfogyasztcsatlakozvezetk felhasznlirendelkeznie kellegy korbbanhomlokzatntervez ltal elrtfigyelembe kellvagy fggleges elrendezsbenutastsnakterv mszakibiztonsgi szempontblmszaki megoldstvdelmtramlsbiztostt nem tartalmazel amelykisebb rtknek megfelelmeglvteljestik ec9 c11telepts tervnelvezetsrelnekszolgl kivezetstszemrevtelezssel kellelhelyezsnekcm2kpezzesrsgtblzatfel kellegybkvetenhegeszt nevthelyezhethogy az gstermkgstermk ramoljonb33 b44ekknt meghatrozottgztzelsh skszlk tpusnvleges teljestmnynlelhelyezni haaz gsi sennek sorngstermk kivezetsre1749 vagy azszikrtaz elrasztsitetszerkezetfellltsi helyisg falnl100 m3hautomatikus zrazonos lgnyoms trbec tpus egyhegesztberendezs tpust azonostkell elzrteljesgstermk ramoljon gzfogyasztkvetelmnyek szabvnykszlket kiszolglforgalomba hozottvgninevestettmegfelelen kellgstermk kilpsre szolglgyakorlshoz szksgestrszint alattielszv ventiltortbb gzfogyaszt kszlketterekkzvetlenelrendezsi sma szerintvdtvolsgkdk aeroszolok levegvelmkd gyjtberendezstztr utni ventiltorralrendelkezmegnevezstmeg az mszkszlk gyrtja sotszllapotnaktztrhuzat elvn mkdrintettkszlk gstermkt elvezetzemzavarlegalbb 05rtketvezetk telephelyikivezetsekkiviteltl fggenkialaktottnylsokhhatsfeleljen meg azkszlkmodulkivezetsre szolgl nylsaitkszlk konstrukcissszenyitottkszlk zembekell meghatroznirszeknt a gzfogyaszthegesztetttlnyoms kialakulsa nemjegyediramlsbiztost nlklikszlk teleptsre vonatkozhajlkonypleten belli hatrolaknsvagy tbbnlkli gzfogyaszt kszlkkszlkek fellltsis gzmrkvnlmegadottvis alakjtcsanyagszolglramliktr illetvevdelemmelvezetkbekerlfigyelembe vvevgezniszmbiztostaniazembe helyezstkszlkek srendelkez gzfogyaszt kszlkekvzszintes elrendezs gstermkgzfogyaszts az ptsggyelb13kszlkcsere bizonylatontlnyoms kialakulsaelvezetsevrhats mkdskszlk s azfggleges elrendezskialakulsa nemltal elrt szerelsirobbankpes lgtrhasznlatonszerkezeti7 cfoglaltkizrlag a gzfogyasztelrsokatha a kttelephelyi vezetk zemitipuslemeg hogyattlszomszdos pletek szerkezetekrobbansveszlyes zna26szellznylstteljestikcsatlakoztatnigyrt elrsarobbansbiztosm lehetnem koncentrikusgyorszrgstermkelvezetkntalapanyag megnevezstaz estben hallellenrzsthegesztberendezs tpustvzszintes elrendezsbenvan sb braa2c13 tpus gzfogyaszthogy azonos lgnyomsb21utnhegesztsi naplnak tartalmazniariasztgzfogyaszt kszlketgstermkelvezethz amelybengstermket vezet tereitmunkinakcsatlakozsirtknek megfelelrendszer gstermkelvezethz kellprbazemel nem2valamennyivgezhetfmelvezetsvel kapcsolatos sajtosbetervezniramoljon gzfogyaszt kszlkekfelhasznlsvalzemeaz adottkell elhelyeznitrtnkarimsgstermk kivezetszembe helyezseazzal legalbbmretezsi eljrsgzmrkrobbansibell azvagy fogyaszti vezetkelvezetsmsodikkszlk gyrtjaszabvnyoktzvdelmivagy hasznlatiltelvezetsre szolgl kzskezelni kpesatartalmaznia kellc13haladhatja megveszis ramlstechnikais az zemiazzalminstett kiviteligztmrenb33 b44 b52elhelyezs esetnb44 b52megfelel megoldsokattmrsgi prbnak kells az mszc102fellltsi helyisgbencsatlakozvezetk s fogyaszti1 mellkletbeptsikwnl nagyobb egyttesosztlybagstermkelvezet kitorkollst17gtgznyomsszablyozrl2esszerelnilgtrbenhuzamosltal elrtbemen nyomss zembe helyezsekiviteli tervet ksztbeszvsra szolglkialaktstlpletek szerkezetek akadlyoknylsainakfelhasznlsiszerelvnnyelsorn a terveznekmellkelt dokumentcijbanaz rtketelhelyeznihelyisgekben teleptendzemszervdelmt biztostanipbgz szolgltat telephelyielrendezsnekkorm rendeletnyomsprba srobbanshomlokzati kivezetsselteleptsivagy a 7tztr utni ventiltort29bra als brarszerendszer sjelentsen veszlyt azcsatlakozvezetk a telephelyikvetelmnyeknekegyenrtk mszakiezzeltereit hatrolbiztostjaelhelyezni a gzfogyasztvltal kivlasztottmternlgstermkelvezet berendezsek htartalmaznia kellanbspatermszetes huzatllapotban vanvagy fgglegeskifogstalanlgternekkialakulhelyisgbl nyerikszenlti llapot vagykszlk tbbb14 b22 b23esetneredmnyestnyeztelepthetkgyermekekgstermkelvezetknt hasznlt jratbelertve azkormemberitervnsmaakkor a nylsokatc8meg kellvezetkeinekhatsraisoaz gstermkelvezetkszlk gstermk kilpsreszintjeals brarsze szerintiltal a gzfogyasztesetben hakivtelamelyet a gzfogyasztvonatkoz sajtosbra szerinti smnakveszlyt az pletbenbepthetralapanyagtevkenysg helyszni irnytsvalegyidejals brarszegy kell kialaktanielrsszmeg 20200417helyezsteredmnyezalkalmazsa esetnminstsegstermkelvezethz kell csatlakoztatnib14 tpuselegendnyomsviszonyok hatsa alattc15 tpuselvezetse tbbegyszerstett kszlkcsere bizonylatongpszetigz nyomsnake pontlgykivezetsnltechnolgiakszlkkelgzfogyaszt kszlkeknlaz gsiburkolat41ms mszakivagy zrtgsi s azalatt lvegyedileg kellfalnlhogy azok megfelelnekgzkibocstsikialaktanisllyesztettb tpuskell csatlakoztatnivegyess ramlstechnikai mretezsiteleptstsmk egyikehelyezse 135karbantartsmeg azt azlevegbevezethzgstermk elvezetsnekszolgltat telephelyibra felsznagzfogyaszt kszlkekgzfogyaszt kszlk helyisgnekrelatv srsgsorszmtegy gzfogyasztvagy msberendezsek hkorltozsokmeghatrozottak szerintramoljon60nevtgz alvagy idom anyagminsgtberendezsek ltalnosh s ramlstechnikaielhelyezked ventiltorral elltotthegesztsikszlk vagyelvezets mshelyszni irnytsval rsbancsatlakozvezetkben mszaki kvetelmnyekvillamos hlzati csatlakozssalkzs gstermkelvezetbl gstermklgkrigzfogyaszt kszlkek gstermkhelyekivitelezjnek rendelkeznie kellzr szerelvnnyeltartzkodsra szolgl helyisgbenterletenterletileg illetkesegyedi gznyomsszablyoz llomsaz 56lefvat szelepirnytsval rsbanfggetlenl forgalomba hozottamikorzemine befolysoljahtgulsi lefvatelrendezsi smagy kell megvlasztanikszlk gyrtja ltalc10brarsze szerintimegfelel elrendezsben kellhaladhatjagzelltst45sszefggazzal lgtrsszekttetsben lvne haladja megvgzettegyedi gznyomsszablyoz llomsokzemi nyomsonmkdstkls falralgnyoms trbe140 kw egysghterhelstzelstechnikai alkalmazsa20200417 kiegsztvarratotvezetk nyomvonaltzemtfeleljenekberendezsselpe31egyttesgyrtja s azszerelvnyhelyisggelellenrzttfelhasznlsi helyfelhasznlsi helyenszablyzatvagy a 33nyomsonlegfeljebb 140 kwgzfelhasznl technolgiai rendszerekkivitelezst vgz gzszerelkombinltmsodik indexbenbelltsialkotott keverkblrszei amelyek megakadlyozzkszilrdsgi nyomsprbaleveg beszvsratalajszint1es znt eredmnyezteljestmnnyel zemel gzfogyasztgstermknekkell biztostaniszmtottnyomsmralkalmaznikvlirszhelyezhetks a gzfogyasztfeltltdsekfellltsi helyisgbl nyerikszlka tztr utnszemlynekbeszvsra s gstermknekegy fogyaszticl70 kwtpus gzfogyaszt kszlkhez54nem haladgster tzelberendezsek gstermkelvezettlnyomsosesetn az mszkszlk fgglegesmegfelel smkabbankszlk brmelyhivatkozssalbra szerintihtechnikaitztr elttiismtelt zembepontbanlershozvagy ezzelhegesztsi felelsrszeivelaz rtket amelyetrszletes szablyairlszellztet leveg beterveznek megzembe helyezsreilletkes fldgzelosztsztatikus feltltdsekkapcsolatossztatikusgyjt rendszer gstermketkzvetettventiltort tartalmaztevkenysgetaztgzipari23tpus termszetesghet gz nyomsnakberendezsei szabvnynakezekkel legalbbbrarsze szerinti smnakkszlket egyannakgstermkelvezethz csatlakoztathatktelepts sornkszlka tztr elttitevkenysgekb4kvetelmnyeiaz ptsgyi s152871 gstermkelvezetle kellismteltenlgelltsakilpsre szolgl kivezetstgyjt rendszerteljestmnynyilatkozattalgstermkt vezetszakaszat gstermk ramoljonegy fggleges pletszerkezetikszlka tztrhegesztsi naplnakfelelssel valamintmegoldsnak36ltalbanegy helyisgbenramoljon gzfogyasztc7kszlkvdcsbencentrpletszerkezetikell tekinteni hogyszakgi mszaki15vdtvolsgokgzfogyaszt kszlk tbb43s csidomszerkezetileg stzelberendezsbiztostani kell hakszlk teleptserobbansbiztos kivitelestben hakdk aeroszolokhegesztst vgzk steleptenivissza a tartalomjegyzkhezkikapcsolt llapottsajtoszntkwcsatlakozvezetkekkorbban gstermkelvezetkntezekkel legalbb egyenrtkszmt keltt stvolsgraszabvny elrsainakltal mszakibiztonsgimegfelel sma szerintkvetszembennagyobb egyttesokozzemi llapotbancskkentettahhoznyitott vagy zrtgstermkelvezetbl csak olyanalkalmaskvlbeptstklnllkszlk brmely terhelsi133841bra fels brarszeb23 b32c15 tpus gzfogyaszttzelstechnikai alkalmazsa esetntartzkodsrac9 c11 c13gstermkt elvezet szakaszaibanarraventiltorraloldalelemnekspeciliskiviteli tervtl valamelyekpasszvakkor a robbansinem megfelelhogy azonosmelynektelephelyi vezetkvagy azzal egyenrtk7 btekinteni hogy azokzrt llapotbanhelyisgben sksztettkell kialaktanitermszetescentr 1749legnagyobb zemikszlk teleptsnek tervezsevagy a gzfelhasznllerstklnnylsait tartalmazventiltorral elltott ramlsbiztostttervgztroltszekrnybengzvezetkpbgz elltsbanbelpidertve a kikapcsoltdnszabadba vezet nylsainakkszlkekheznagyobb mretc113belpskszlk gyrtjnakkiadottesetn a tervezpbgz forgalmaz ltalfggleges elrendezsben140 kwnl nagyobbsszekttetsben lvkell elhelyezni hab22 b23rszeknt tanstott3asez a tvolsgkialaktsvalbrmelyhatlyatzelberendezsekhterhelscselleni vdelmtc1 c3olyan rszei amelyekj gzfogyaszt kszlkalatt azitmemberi tartzkodsraszomszdoshzi gznyomsszablyozrintsvdelem6gy kell megterveznielszvnem lehetmegnevezst cs vagyhuzalhl vagy rcskivitelezse srendelkez gzfogyaszt kszlkcsatlakoztatni azszolgl kzsmegoldstteleptsnekegyike szerint kellkell hegesztsigstermkelvezetbl gstermk ramoljonkw egyttesgznyomsszablyozkgyjt rendszer gstermkelvezethzesetben a gzfogyasztsdnbspaieckell aztvezet gstermketszempontblhelye tpusakialaktsnakgzfogyaszt kszlktl fggetlenlrbc11betartsvalzemeltetilletve padlszint alattvszszellztetkszlk csakszmt kelttenergetikaizembe helyezse 1veszlytmsz en 152872szablyozgzfogyaszt kszlk vagygstermk kilpsreltal mszakibiztonsgi szempontblhelyezfelszereltbiztonsgtechnikaihozzezekutni ventiltorralgstermket vezetc4elszrhatmembrnos lemezhzasvannakcsatlakozsi nyomsszablyozsra szolglb22legalbb 15nyilatkozatvonatkoz mszaki biztonsgiramlstechnikai mretezsib43elleni vdelemmel kellkell elhelyezni hogya3als brarsznek megfelelkszlktl fggetlenlpadlszint alatt lvkivitelezsre alkalmasnakbrk als brarszegsi levegt egyterleti fldgzeloszt vezetkeskszlkek elhelyezsnek sajtos37 pontjbanellenillomsok10hegeszts kivitelezjnekirnytsval rsban megbzottvagy a 461 rsz nyitottbe skvetkezkfelhasznlzembegstermkelvezethz amelyben tlnyomsgzfogyaszt kszlk gsitblzatbantet felettibelsejbens gstermketkszlk rszeknt tanstottvagy vzszintes elrendezsbenbiztonsgi kvetelmnyeihelyisgebiztostani kellberendezsnekelrsokkitorkollsjelezrjelbenfels brarsznek megfelelhelyisgeibegyakorlshozllomsratartalmazniakivtelvelha a kvetkezszabadon7 a vagyrobbansi helyzet hatsaieltti ventiltortelhelyezni hogy azonosrendszerekcsatlakozsamelyetteleptsszabvnyossgitartskialakul tlnyoms rtketvolsgaz ghetigazolniatpust azonostvagy a telephelyibeavatkoz kszlkkelhelyisgamely a gzfogyaszthomlokzaton kell elhelyeznis a fogyasztimrtkaz alkalmazottforgalmaznyomsnak szablyozsra szolglzemi szellztet levegrendszer levegbevezetthegesztsseltartzkodsra szolglvonalszablyosmszaki megoldsnaknyomselrendezsben kell teleptenirendszer rsztteljestmnnyelkszlk esetbenkivezetssma szerint kellvezetk nem helyezhetterveznizeme sornszakaszaibanelrsokontevkenysgekw egysghterhels14azok e59szilrdsgiakikonstrukcistzelberendezsek gstermkelvezet berendezseiszakmagyakorlsi tevkenysgekrl szl28nem tartalmaz gzfogyasztbiztostanielttgstermk elvezetstrfigyelembe kell vennielvn mkd gyjtkszlkenalatt llelrsts gstermket vezetteleptsnek tervezse sornamelyek megakadlyozzk hogyforgalomba hozott rendszergstermkelvezethzkszlk nemfogyasztikszlk amelyb23zsalu huzalhllegalbb 50 mgstermknek kivezetsre szolglvagycszmraszmttpus kszlkrendszerltalnosc5 tpusestbenmegterveznihelyisgekbe a kzsltal megadottfelzrterv mszakibiztonsgitervezni sb13 b21nem csatlakoztathatkivvekilpfalonhelyisg szellzptsgyi s azhelyisgekbe38tartozkainak vdtvolsgtaz jvszszellzeztlnyoms elfordulsa16elrsokaminsljenekhakivitelezse s zembekilltottelvezetstb12 b13 b21c11 c13 c14gznyomsszablyozk s egyedizembenilyen

Longtail Keyword Density for Gmbsz.hu

KeywordsOccurences
tpus gzfogyaszt kszlka106
tpus gzfogyaszt kszlket84
megfelel elrendezsben kell68
tpus gzfogyaszt kszlk58
gzfogyaszt kszlka tztr57
smnak megfelel elrendezsben49
szerinti smnak megfelel46
bra szerinti smnak34
az ipari gznyoms-szablyoz27
s az gstermk-elvezet26
ipari gznyoms-szablyoz lloms24
gstermk kilpsre szolgl23
csatlakozvezetk a fogyaszti23
b tpus gzfogyaszt20
kszlka tztr utni20
kszlka tztr eltti19
tpus gzfogyaszt kszlkek19
egyiknek megfelel elrendezsben19
s a telephelyi18
termszetes huzat elvn18
smk egyiknek megfelel18
szerinti smk egyiknek18
gzfogyaszt kszlka termszetes17
fogyaszti vezetk s17
huzat elvn mkd17
csatlakozvezetk fogyaszti vezetk17
azonos lgnyoms trbe16
tztr utni ventiltorral16
lgnyoms trbe kivezetettnek16
gy kell tekinteni16
ha a gzfogyaszt16
kell tekinteni hogy16
utni ventiltorral elltott16
vezetkes pb-gz szolgltat16
gzfogyaszt kszlk gstermk15
hogy azonos lgnyoms15
gzfogyaszt kszlk gyrtja15
tztr eltti ventiltorral15
gzfogyaszt kszlket az15
gzfogyaszt kszlk fellltsi15
egyenrtk ms mszaki15
egyttes hterhels gzfogyaszt14
elhelyezked ventiltorral elltott14
s a fogyaszti14
eltti ventiltorral elltott14
abban az esetben13
telephelyi szolgltat telephelyi13
gzfelhasznl technolgiai rendszer13
kell elhelyezni hogy13
gy kell elhelyezni12
als brarsze szerinti12
vagy a pb-gz12
megoldsokat gy kell12
fels brarsze szerinti12
szolgltat telephelyi engedlyes12
huzamos emberi tartzkodsra12
brarsze szerinti smnak12
emberi tartzkodsra szolgl12
gstermk-elvezethz kell csatlakoztatni11
brarsze szerinti smk11
leveg-bevezet s az11
gzfogyaszt kszlk teleptse11
elrendezsben kell teleptenivissza11
teleptenivissza a tartalomjegyzkhez11
fellltsi helyisg lgterben10
s a gzfogyaszt10
vezetk telephelyi vezetk10
fogyaszti vezetk telephelyi10
gy kell megtervezni10
vagy azzal egyenrtk10
s telephelyi vezetk10
gzfogyaszt kszlkek elhelyezsnek10
hterhels gzfogyaszt kszlkek10
termszetes tztrhuzat elvn10
tbb gzfogyaszt kszlk10
tztrhuzat elvn mkd10
tekinteni hogy azok10
vagy kzponti rendszer10
az en 174910
elhelyezni hogy azonos9
elhelyezse nem koncentrikus9
s zembe helyezse9
kszlka tztr utn9
kivitelezse s zembe9
pb-gz szolgltat telephelyi9
telephelyi engedlyes vagy9
s fogyaszti vezetk9
nem koncentrikus akkor9
tervezse kivitelezse s9
berendezsek tervezse kivitelezse9
gstermk-elvezet berendezsek tervezse9
berendezsek gstermk-elvezet berendezsek9
gzfogyaszt kszlk esetben9
terveznek biztostania kell9
bra fels brarsze9
zrt gster tzelberendezsek9
az gsi levegt9
fldgzeloszt vezetkes pb-gz9
szolgltat telephelyi szolgltat9
gster tzelberendezsek gstermk-elvezet9
tzelberendezsek gstermk-elvezet berendezsei9
kzponti rendszer gstermk-elvezethz9
kszlka termszetes tztrhuzat9
kszlka tztr eltt9
kw egyttes hterhels9
leveg beszvsra s9
c tpus gzfogyaszt9
azzal lgtr-sszekttetsben lv8
bra als brarsze8
terleti fldgzeloszt vezetkes8
gzfogyaszt kszlk fggleges8
hogy a gzfogyaszt8
kilpsre szolgl kivezetst8
nem huzamos emberi8
ha a leveg-bevezet8
elrendezsben kell telepteni8
kszlk gstermk kilpsre8
gzfogyaszt kszlk gstermkt8
tartzkodsra szolgl helyisgben8
esetn a tervez8
kszlket a fellltsi8
vagy a 78
tztr eltt elhelyezked8
eltt elhelyezked ventiltorral8
kszlk gyrtja ltal8
gyjt rendszer gstermk-elvezethz8
azzal egyenrtk ms8
gzfogyaszt kszlk az8
gzfogyaszt kszlk vagy8
tztr utn elhelyezked8
kszlka termszetes huzat8
gzfogyaszt kszlk s8
csatlakozvezetk s fogyaszti8
trbe kivezetettnek minsljenek7
esetben a gzfogyaszt7
s az gstermk7
lgtr-sszekttetsben lv helyisgekben7
felhasznli berendezs s7
pb-gz forgalmaz ltal7
kell hogy az7
gzfogyaszt kszlk rszeknt7
az gstermk-elvezet szabadba7
ipari htechnikai berendezsek7
ez a gzfogyaszt7
biztostania kell hogy7
vezet nylsainak elhelyezse7
szabadba vezet nylsainak7
alkalmazott mszaki biztonsgi7
nylsokat gy kell7
kell megtervezni hogy7
mszaki megoldsokat gy7
gstermk-elvezet szabadba vezet7
az egyszerstett kszlkcsere7
rendszer gstermk-elvezethz kell7
utn elhelyezked ventiltorral7
nylsainak elhelyezse nem7
2 rsz zrt7
kivezetst a tet7
bra szerinti smk7
gzfogyaszt kszlket kiszolgl7
gyjt vagy kzponti7
gstermk-elvezet tbb gzfogyaszt7
rsz zrt gster7
centr 1749 vagy6
nagyobb egyttes hterhels6
hzi gznyoms-szablyozk s6
akkor a nylsokat6
gznyoms-szablyozk s egyedi6
kzs gyjt vagy6
leveg beszvsra szolgl6
rendszer gstermk-elvezethz csatlakoz6
az elzr szerelvny6
ramlsbiztostt nem tartalmaz6
sma szerint kell6
amelyek megakadlyozzk hogy6
ipari gznyoms-szablyoz llomson6
szabvny vagy azzal6
az gstermk elvezets6
szolgl nylsait tartalmaz6
helyezhet el ha6
msz en 15287-26
smk egyike szerint6
kszlk fggleges elrendezs6
gy kell kialaktani6
helyisgben s az6
szolgl helyisgben s6
kisebb rtknek megfelel6
kzl a kisebb6
legalbb egyenrtk mszaki6
egyenrtk mszaki megoldsokat6
gzfogyaszt kszlkek gstermk6
helyezse 2 rsz6
ltal megengedett mrtk6
megfelel smk egyike6
az azzal lgtr-sszekttetsben6
fggleges vagy vzszintes6
az a tpus6
egyike szerint kell6
kell elhelyezni s6
vezetk a telephelyi6
zembe helyezse 26
gyrtja ltal megengedett6
csak olyan gstermk-elvezethz6
s az azzal6
b bra szerinti6
b22 tpus gzfogyaszt5
kilpsre szolgl kivezetse5
als brarsznek megfelel5
egy termszetes huzat5
hatsa alatt ll5
beszvsra s gstermknek5
bra als brarsznek5
tztr eltti ventiltort5
gzfogyaszt kszlk helyisgnek5
eltti ventiltort tartalmaz5
gstermk-elvezet berendezsek gstermk-elvezet5
membrnos lemezhzas gzmr5
utni ventiltort tartalmaz5
kell a gzfogyaszt5
gzfogyaszt kszlket egy5
c12 tpus gzfogyaszt5
gyjt rendszer gstermket5
rzkel s beavatkoz5
gzfogyaszt kszlkek helyisgnek5
gyrt ltal megadott5
fltt kell elhelyezni5
ezeket a nylsokat5
vagy ms helyisgekbe5
tztr utni ventiltort5
fellltsi helyisgen tvezet5
elrendezs gstermk kilpsre5
ipari gznyoms-szablyoz llomst5
tlnyoms kialakulsa nem5
legfeljebb 140 kw5
1749 vagy az5
140 kw egyttes5
rendszer gstermket vezet5
gstermk-elvezet berendezsei szabvny5
32020 i 135
megfelelnek e pont5
h- s ramlstechnikai5
telephelyi vezetk s5
tpus gzfogyaszt kszlkhez5
egy eloszt rendszer5
gzfogyaszt kszlk szabadba5
csatlakozvezetk a felhasznli5
gzfogyaszt kszlk leveg5
gyrtja s az5
kszlk leveg beszvsra5
gzfelhasznl technolgiai rendszerek5
az gstermk-elvezet gyrtja5
szakaszaiban a gzfogyaszt5
rendelet 1 mellklet5
gstermk-elvezet gyrtja ltal5
megengedett mrtk tlnyomsok5
mrtk tlnyomsok kzl5
vagy a telephelyi5
brarsznek megfelel smk5
msz en iso5
vezetk s telephelyi5
gzfogyaszt kszlk csak5
csatlakozvezetk a telephelyi5
kszlk gyrtja s5
fggleges pletszerkezeti jratban5
leveg-bevezett is tartalmaz5
mszaki biztonsgi szablyzat5
elzr szerelvnyt kell5
kszlk gstermkt elvezet5
gstermkt elvezet szakaszaiban5
mszaki biztonsgi elrsokat5
rendelkez gzfogyaszt kszlk5
az pleten bell5
140 kw-nl nagyobb5
ms mszaki megolds5
az zemi szellztet5
zemi szellztet leveg5
csatlakozvezetk felhasznli berendezs5
kw-nl nagyobb egyttes5
kszlk fellltsi helyisgben4
szerelvnyt kell bepteni4
mszaki biztonsgi szempontbl4
elvezet berendezsek gstermk-elvezet4
tpus termszetes huzat4
gstermk elvezet berendezsek4
15287-2 gstermk elvezet4
azok megfelelnek e4
s az j4
mrtk tlnyoms elfordulsa4
megfelel mrtk tlnyoms4
rtknek megfelel mrtk4
elltsban alkalmazott mszaki4
fldgzeloszt a vezetkes4
pb-gz elltsban alkalmazott4
kzponti rendszer gstermk-elvezetbl4
fels brarsznek megfelel4
bra fels brarsznek4
gzfogyaszt kszlkek gstermknek4
gstermk-elvezet berendezsek h-4
ezekkel legalbb egyenrtk4
b5 tpus gzfogyaszt4
vagy az egyszerstett4
gzfogyaszt kszlk esetn4
gzfogyaszt kszlk tbb4
gzfogyaszt kszlkek fellltsi4
gznyoms-szablyoz lloms zembe4
kszlk fellltsi helyisgnek4
elltott ramlsbiztostt nem4
ventiltorral elltott ramlsbiztostt4
kizrlag a gzfogyaszt4
egyedi gznyoms-szablyoz llomsok4
s egyedi gznyoms-szablyoz4
tartalmaz gzfogyaszt kszlka4
zembe helyezs eltti4
7 b vagy4
nem tartalmaz gzfogyaszt4
felhasznli berendezsek s4
az esetben ha4
esetn a szerelsi4
e pont kvetelmnyeinek4
sorn a terveznek4
legnagyobb zemi nyoms4
ltal a gzfogyaszt4
kszlk s az4
gzkoncentrci rzkel s4
vezetk trszint alatti4
berendezsek h- s4
s ramlstechnikai mretezsi4
rendelkez gzfogyaszt kszlkek4
vagy a gzfelhasznl4
gzfogyaszt kszlkek esetn4
teleptsnek tervezse sorn4
kszlk teleptsnek tervezse4
gzfogyaszt kszlk teleptsnek4
kszlk rszeknt tanstott4
hogy a kzs4
ha a kvetkez4
terveznek meg kell4
gzfogyaszt kszlk nem4
pletszerkezeti jratban kell4
beszvsra s gstermk4
leveg be- s4
sorn biztostani kell4
szellztet leveg be-4
gzfogyaszt kszlkhez mellkelt4
rszt kpezze amely4
rendszer rszt kpezze4
s gstermk kilpsre4
koncentrikus akkor ezeket4
az gstermk-elvezet egy4
gstermk-elvezethz amelyben tlnyoms4
b brk fels4
elhelyezsre szolgl helyisg4
brk fels brarsze4
egyedi gznyoms-szablyoz lloms4
d bra szerinti4
szabvny elrsainak vagy4
b brk als4
brk als brarsze4
gy kell megvlasztani4
kell megvlasztani hogy4
s a hegesztsirnyt4
fggleges elrendezsben kell4
az arh 204
c11 tpus gzfogyaszt4
lv helyisgekben teleptend4
az plet homlokzatn4
gz nyomsnak szablyozsra4
c13 tpus gzfogyaszt4
s gstermknek kivezetsre4
gstermknek kivezetsre szolgl4
forgalomba hozott rendszer4
valamint a hegesztsi4
rz s rztvzetek4
kell kialaktani hogy4
hogy azok megfelelnek4
nem haladhatja meg4
nem lehet nagyobb4
szakaszban tlnyoms kialakulsa4
fggleges elrendezs gstermk4
tet fltt kell4
tervez ltal meghatrozott4
automatikus zr szerelvny4
biztostani kell hogy4
helyisg lgterben egy4
lennievissza a tartalomjegyzkhez4
eloszt rendszer leveg-bevezett4
ezzel egyenrtk ms4
kpezze amely egy4
amely egy eloszt4
feleljen meg az4
vagy ezzel egyenrtk4
el kell vgezni4
tvolsgban helyezhetk el3
kszlken t gstermk3
cskkentett teljestmnnyel zemel3
gsi leveg beszvsra3
egymshoz elgsgesen kzel3
teljestmnnyel zemel gzfogyaszt3
gstermk-elvezetknt hasznlt jrat3
zemel gzfogyaszt kszlken3
biztonsgi szempontbl egyenrtk3
gzfogyaszt kszlken t3
rendszer gstermk-elvezethz amelyben3
t gstermk ramoljon3
gstermk-elvezethz kell csatlakozatni3
rendszer gstermk-elvezetbl csak3
gstermk-elvezetbl csak olyan3
ramoljon a gzfogyaszt3
tvezet gstermket vezet3
kszlk fellltsi helyisgbe3
fellltsi helyisgbe vagy3
helyisgbe vagy ms3
gzfogyaszt kszlk tpus3
helyisgekbe a kzs3
gzfogyaszt kszlkek amelyeknek3
b bra als3
kivezetettnek minsljenek ez3
nincsenek olyan rszei3
ltal elrt szerelsi3
kszlkek amelyeknek nincsenek3
gstermk-elvezethz csatlakoztathatk amely3
kszlktl fggetlenl forgalomba3
rszeknt a gzfogyaszt3
az zembe helyez3
gzfelhasznl technolgiai rendszert3
telephelyi vezetk zemi3
vonatkoz mszaki biztonsgi3
vagy fggleges elrendezsben3
amelyeknek nincsenek olyan3
olyan rszei amelyek3
kszlk szabadba vezet3
rszei amelyek megakadlyozzk3
vzszintes vagy fggleges3
hogy a kikapcsolt3
kikapcsolt kszenlti llapot3
fggen vzszintes vagy3
helyezhet zembe ha3
gzfogyaszt kszlktl fggetlenl3
fggetlenl forgalomba hozott3
kszenlti llapot vagy3
vagy a cskkentett3
kiviteltl fggen vzszintes3
vagy vzszintes elrendezsben3
olyan gstermk-elvezethz csatlakoztathatk3
s nyomsviszonyok hatsa3
csatlakoztathatk amely olyan3
egy fggleges pletszerkezeti3
53 b brk3
kell csatlakoztatni az3
gstermk-elvezet egy olyan3
s a leveg-bevezet3
mkd gyjt rendszer3
elvn mkd gyjt3
fellltsi helyisg falnl3
elfordulsa megengedett az3
gzfogyaszt kszlk gsi3
fellltsi helyisg lgtern3
c15 tpus gzfogyaszt3
pletszerkezeti jratban helyezkedjen3
vagy a 343
jratban helyezkedjen el3
s gstermket vezet3
53 a vagy3
tlnyoms elfordulsa megengedett3
llapott is kezelni3
gsi levegt egy3
jratban kell elhelyezni3
kszlkhez a fellltsi3
helyisg lgterben csatlakoz3
elhelyezni a gzfogyaszt3
gzfogyaszt kszlk gstermk-elvezethz3
kszlk gstermk-elvezethz nem3
gstermk kivezetsre szolgl3
homlokzaton kell elhelyezni3
kszlk gstermkt vezet3
vagy a 473
elvn mkd gzfogyaszt3
vagy a 463
vagy vzszintes elrendezs3
vzszintes elrendezs gstermk3
vagy a homlokzaton3
helyezkedjen el amely3
idertve a kikapcsolt3
amely olyan rszegysgeket3
korbban gstermk-elvezetknt hasznlt3
gstermk elvezetse tbb3
az gstermk elvezetse3
hogy az gstermk3
beszvsra szolgl nylsait3
nyomsviszonyok hatsa alatt3
egy korbban gstermk-elvezetknt3
helyisgeibe vagy ms3
telepts sorn vltoztathat3
fellltsi helyisgeibe vagy3
kszlkek fellltsi helyisgeibe3
ramoljon gzfogyaszt kszlkek3
gstermk ramoljon gzfogyaszt3
gstermk-elvezetbl gstermk ramoljon3
kzs gstermk-elvezetbl gstermk3
kivezetsre szolgl nylsait3
gstermknek elvezetsre szolgl3
kszlkhez mellkelt dokumentcijban3
el amely egy3
az rtket amelyet3
terhelsi llapotban idertve3
brmely terhelsi llapotban3
kszlk brmely terhelsi3
gzfogyaszt kszlk brmely3
amelyet a gzfogyaszt3
amely egy korbban3
vagy a 333
elvezetsre szolgl kzs3
azt az rtket3
meg azt az3
haladja meg azt3
ne haladja meg3
rtke ne haladja3
tlnyoms rtke ne3
kialakul tlnyoms rtke3
helyisgen tvezet gstermket3
csatlakozssal rendelkez gzfogyaszt3
megfelel sma szerint3
tevkenysg helyszni irnytsval3
varratok szemrevtelezses ellenrzsnek3
varrat azonost sorszmt3
szmt keltt s3
hegeszt nevt azonost3
idom anyagminsgt s3
vagy idom anyagminsgt3
cs vagy idom3
megnevezst cs vagy3
alapanyag megnevezst cs3
hegesztberendezs tpust azonost3
vezetk megnevezst azonost3
hegesztsi naplnak tartalmaznia3
irnytsval rsban megbzott3
helyszni irnytsval rsban3
hegesztsi tevkenysg helyszni3
varraton vgzett javtsok3
hegesztsi felelssel valamint3
kell hegesztsi felelssel3
rendelkeznie kell hegesztsi3
kivitelezjnek rendelkeznie kell3
hegeszts kivitelezjnek rendelkeznie3
alkalmasnak minstett kiviteli3
kivitelezsre alkalmasnak minstett3
mszaki kvetelmnyek szabvny3
s az msz3
vagy az msz3
elrsainak vagy ezzel3
meg az msz3
ms mszaki elrs3
s a gzfelhasznl3
szemrevtelezses ellenrzsnek eredmnyt3
hegesztst vgzk s3
kell lennie az3
gsi- s az3
s a tervez3
meg a gyrt3
fldgzeloszt telephelyi szolgltat3
terleti fldgzeloszt telephelyi3
ha a kt3
megfelel megoldsokat gy3
mrett s alakjt3
lefvat szellznylsa kivezetsnl3
biztonsgi lefvat szellznylsa3
huzalhl vagy rcs3
zsalu huzalhl vagy3
szabadba nyl vgn3
be- s kivezetsre3
s az zemi3
az gsi- s3
tervez ltal elrt3
s mkds szempontjbl3
szerkezetileg s mkds3
padlszint alatt lv3
illetve padlszint alatt3
tr- illetve padlszint3
ce megfelelsgi jellssel3
alakjt a terveznek3
znt eredmnyez melynek3
1-es znt eredmnyez3
vagy azzal legalbb3
az j hegesztsi3
vgni s az3
kell vgni s3
ki kell vgni3
az acl anyag3
kell elhelyezni ha3
12279 gzellt rendszerek3
amely a gzfogyaszt3
kdk aeroszolok levegvel3
vagy kdk aeroszolok3
az gstermk kivezets3
gyrtja ltal elrt3
pontjban ekknt meghatrozott3
csatlakozvezetket fogyaszti vezetket3
amelyen a gznyoms-szablyoz3
ltal mszaki-biztonsgi szempontbl3
kiviteli tervet kszt3
esetn a kiviteli3
szolgltat a telephelyi3
gzfogyaszt kszlk helyisgbe3
gzfogyaszt kszlkek s3
berendezs s telephelyi3
egyszerstett kszlkcsere bizonylaton3
levegvel alkotott keverkbl3
fellltsi helyisgbl nyeri3
levegt a fellltsi3
kszlk fellltsi helyisgbl3
meghatrozott gzfogyaszt kszlk3
pontjban meghatrozott gzfogyaszt3
37 pontjban meghatrozott3
3 37 pontjban3
get 3 373
20200417vissza a tartalomjegyzkhez3
kszlk esetn az3
nem helyezhet el3
gznyoms-szablyoz lloms gpszeti3
vonatkoz sajtos kvetelmnyek3
fogyaszti vezetk rejtett3
aeroszolok levegvel alkotott3
alkotott keverkbl ll3
nagyobb relatv srsg3
foglaltak alapjn kell3
biztostani kell ha3
vdelmt biztostani kell3
elleni vdelmt biztostani3
legalbb a kvetkez3
telephelyi szolgltat vagy3
terletileg illetkes fldgzeloszt3
fogyaszti vezetk nyomvonalnak3
kivitelezst vgz gzszerel3
meg a tervezsi3
tekinteni hogy az3
tervez a robbansveszlyes3
vdtvolsgt a tervez3
vezetk nem helyezhet3
nyomvonalt gy kell3
tzelstechnikai alkalmazsa esetn3
keverkbl ll robbankpes3
az ptsggyel sszefgg3
ll robbankpes lgtr3
egy vagy tbb3
rszletes szablyairl szl3
az ptsgyi s3
ptsgyi s az3
s az ptsggyel3
ptsggyel sszefgg szakmagyakorlsi3
telephelyi vezetk nyomvonalt3
sszefgg szakmagyakorlsi tevkenysgekrl3
szakmagyakorlsi tevkenysgekrl szl3
terv mszaki-biztonsgi szempontbl3
mszaki-biztonsgi szempontbl trtn3
kiviteli tervtl val3
vagy fogyaszti vezetk3
msz en 122793
gzellt rendszerek gznyoms-szablyozk3
b14 tpus gzfogyaszt3
az gstermk-elvezet egyttest3
gstermk-elvezet berendezsei szabvnynak3
nyitott gster tzelberendezsek3
rsz nyitott gster3
1 rsz nyitott3
helyezse 1 rsz3
zembe helyezse 13
15287-1 gstermk-elvezet berendezsek3
msz en 15287-13
kiraml gstermk az3
veszlyt az pletben3
jelentsen veszlyt az3
ne jelentsen veszlyt3
hogy a kiraml3
gzfogyaszt kszlk gstermknek3
elvezetsvel kapcsolatos sajtos3
pletek szerkezetek akadlyok3
azok e pont3
hogy azok e3
ramlstechnikai mretezsi eljrs3
esetn az msz3
tbb gzfogyaszt kszlket3
13384-1 gstermk-elvezet berendezsek3
msz en 13384-13
gzfogyaszt kszlk biztonsgos3
akkor a gzfogyaszt3
ha a szellz3
tervez ltal kivlasztott3
el a gzfogyaszt3
ha a helyisg3
akkor a robbansi3
szomszdos pletek szerkezetek3
homlokzati kivezetssel rendelkez3
s azzal vezrelt3
teleptsre vonatkoz specilis3
7 a vagy3
csatlakozik a gzfogyaszt3
b1 tpus gzfogyaszt3
vezet tereit hatrol3
gstermket vezet tereit3
rszeknt forgalomba hozott3
fellltsi helyisg lgternek3
kzs rendszer gstermk-elvezethz3
az estben ha3
gyjt- vagy kzponti3
kzs gyjt- vagy3
elrendezsi sma szerint3
gzfogyaszt kszlk konstrukcis3
vonatkoz specilis elrsoka3
kszlk teleptsre vonatkoz3
ne befolysolja htrnyosan3
gzfogyaszt kszlk teleptsre3
tpus centr 17493
gzfogyaszt kszlk olyan3
hivatkozssal forgalomba hozott3
tlnyoms alakulhat ki3
csak abban az3
az gstermk-elvezet minstse3
gzfogyaszt kszlk gyrtjnak3
c11 c13 c143
c9 c11 c133
c7 c9 c113
c5 c7 c93
c3 c5 c73
c1 c3 c53
azzal vezrelt vszszellztet3
kszlkkel s azzal3
gznyoms-szablyozk a csatlakozvezetkben3
tmrsgi prbnak kell3
gzfogyaszt kszlk oldalelemnek3
nlkli gzfogyaszt kszlk3
tartzkodsra szolgl s3
kszlkek elhelyezsnek sajtos3
kszlk elzr szerelvny3
s a kszlk3
gzfogyaszt kszlk zembe3
illetkes gzipari engedlyes3
1400 kw egyttes3
140 kw egysg-hterhels3
teljestmnynl nagyobb gzmr3
nvleges teljestmnynl nagyobb3
ez a tvolsg3
az elrasztsi zna3
nyitott vagy zrt3
b11 b12 b133
kivitel ipari gznyoms-szablyoz3
akns kivitel ipari3
nyomsnak szablyozsra szolgl3
ghet gz nyomsnak3
legalbb 50 m3
llomst gy kell3
gznyoms-szablyoz lloms esetben3
az egyedi gznyoms-szablyoz3
nyomsszablyoz lloms gpszeti3
pleten belli hatrol3
kell lennie s3
teljestmny membrnos lemezhzas3
elleni vdelemmel kell3
csatlakozvezetkben mszaki kvetelmnyek3
meg nem halad3
b12 b13 b213
beavatkoz kszlkkel s3
kivezetst gy kell3
s beavatkoz kszlkkel3
helyzet hatsai elleni3
robbansi helyzet hatsai3
szakgi mszaki elrsok3
hlzati csatlakozssal rendelkez3
villamos hlzati csatlakozssal3
hogy a kszlk3
az automatikus zr3
rendszerek biztonsgi kvetelmnyei3
berendezsek 2 rsz3
htechnikai berendezsek 23
el nem zrhat3
teljestik e pont3
figyelembe kell venni3
helyisgben legfeljebb 1403
b14 b22 b233
b53nbsptpus gzfogyaszt kszlk3
b22 b23 b323
b23 b32 b333
b32 b33 b443
b33 b44 b523
b44 b52 b53nbsptpus3
b52 b53nbsptpus gzfogyaszt3
kszlk esetben az3
egy helyisgben legfeljebb3
gzfogyaszt kszlk zemvel3
kszlk csak olyan3
j gzfogyaszt kszlk3
h- s ramlstani3
c tpus egy3
tpus egy helyisgben3
ismtelt zembe helyezs3
gzfogyaszt kszlk338
tpus gzfogyaszt285
gzfogyaszt kszlka116
gzfogyaszt kszlket112
s az97
gzfogyaszt kszlkek90
elrendezsben kell73
fogyaszti vezetk71
megfelel elrendezsben71
telephelyi vezetk58
kszlka tztr57
gy kell55
gznyoms-szablyoz lloms50
smnak megfelel50
bra szerinti49
az msz48
ventiltorral elltott46
szerinti smnak46
az gstermk-elvezet45
kell elhelyezni42
ipari gznyoms-szablyoz39
az ipari33
mszaki biztonsgi30
vagy az29
elvn mkd27
az plet27
szerint kell26
vezetk s25
gstermk-elvezet berendezsek25
hogy az24
kilpsre szolgl24
brarsze szerinti24
gstermk kilpsre23
b tpus23
felhasznli berendezs23
szolgltat telephelyi22
kell lennie22
termszetes huzat22
gzfelhasznl technolgiai22
tztr utni21
gyjt rendszer21
vagy azzal21
tztr eltti20
egyiknek megfelel20
rendszer gstermk-elvezethz20
az gstermk20
kell tekinteni20
gstermket vezet20
egyttes hterhels19
meg kell19
fellltsi helyisg19
gzfogyaszt kszlkhez19
huzat elvn18
pb-gz forgalmaz18
smk egyiknek18
szerinti smk18
tervez ltal18
csatlakozvezetk s18
utni ventiltorral17
vezetkes pb-gz17
csatlakozvezetk fogyaszti17
kszlka termszetes17
bra als17
telephelyi szolgltat17
1 rsz17
trbe kivezetettnek17
kszlk fellltsi17
kszlk gstermk17
tekinteni hogy16
ms mszaki16
lgnyoms trbe16
azonos lgnyoms16
c tpus16
pb-gz szolgltat16
szabadba vezet16
egyenrtk ms15
tartzkodsra szolgl15
leveg beszvsra15
ventiltort tartalmaz15
kszlk gyrtja15
hogy azonos15
biztostani kell15
pleten bell15
az esetben15
elhelyezked ventiltorral15
eltti ventiltorral15
terleti fldgzeloszt15
kzponti rendszer15
bra fels15
kszlket az15
az gsi14
technolgiai rendszer14
gyrtja ltal14
gstermk-elvezethz kell14
ha az14
elhelyezni hogy14
hterhels gzfogyaszt14
zemi nyoms14
telephelyi engedlyes14
elzr szerelvny14
abban az13
fggleges elrendezs13
leveg-bevezet s13
kiviteli tervben13
gsi levegt13
fels brarsze13
tbb gzfogyaszt13
feleljen meg13
forgalomba hozott13
nem lehet13
rendelkez gzfogyaszt13
megoldsokat gy12
kell hogy12
b bra12
gyrt ltal12
huzamos emberi12
emberi tartzkodsra12
kiviteli terv12
terveznek biztostania12
b vagy12
kell csatlakoztatni12
als brarsze12
kell telepteni12
helyezhet el12
pontban meghatrozott12
gster tzelberendezsek12
zembe helyezse12
lgtr-sszekttetsben lv12
csak olyan12
alapjn kell11
kszlk teleptse11
valamint az11
zrt gster11
s zembe11
nem koncentrikus11
e pont11
2 rsz11
egyszerstett kszlkcsere11
kell megtervezni11
el kell11
s gstermk11
kell teleptenivissza11
egyenrtk mszaki10
nylsainak elhelyezse10
az alkalmazott10
vagy kzponti10
tztr utn10
vagy ms10
hogy azok10
az zembe10
vezetk telephelyi10
elhelyezsre szolgl10
140 kw10
szolgl kivezetst10
kw egyttes10
berendezsek tervezse10
tztrhuzat elvn10
termszetes tztrhuzat10
tztr eltt10
kell bepteni10
mszaki-biztonsgi szempontbl10
azzal egyenrtk10
gstermk elvezets10
az ghet10
helyisg lgterben10
fldgzeloszt vezetkes10
kszlkek elhelyezsnek10
trszint alatti10
s fogyaszti10
s telephelyi10
kszlk az9
eltt elhelyezked9
nem helyezhet9
alkalmazott mszaki9
mszaki megolds9
h- s9
kell kialaktani9
kszlk esetben9
legalbb egyenrtk9
gsi leveg9
engedlyes vagy9
gstermk-elvezet berendezsei9
tzelberendezsek gstermk-elvezet9
kivitelezse s9
tervezse kivitelezse9
berendezsek gstermk-elvezet9
biztostania kell9
gznyoms-szablyoz llomsok9
egyedi gznyoms-szablyoz9
fellltsi helyisgben9
szabadba nyl9
biztonsgi lefvat9
tmrsgi prba9
brarsznek megfelel9
centr 17499
gstermk-elvezet szabadba9
elhelyezse nem9
koncentrikus akkor9
beszvsra s9
amely egy9
az egyszerstett8
s beavatkoz8
ltal elrt8
kszlk s8
kszlk fggleges8
szakgi mszaki8
kszlk vagy8
azzal lgtr-sszekttetsben8
pletszerkezeti jratban8
szerelvnyt kell8
gstermk-elvezethz csatlakoz8
esetn az8
kszlk gstermkt8
mszaki megoldsokat8
b brk8
nem huzamos8
szolgl nylsait8
vonatkoz sajtos8
zembe helyezs8
szolgl helyisgben8
utn elhelyezked8
az elzr8
tlnyoms kialakulsa7
el ha7
megtervezni hogy7
az pletbe7
ipari htechnikai7
s annak7
szme-g 202004177
fogyaszti vezetket7
kivezetettnek minsljenek7
korm rendelet7
rsz zrt7
teleptsre vonatkoz7
gstermk-elvezethz nem7
az zemi7
vonatkoz kvetelmnyek7
gyjt vagy7
szellztet leveg7
sma szerint7
lv helyisgekben7
gz al7
olyan gstermk-elvezethz7
20200417 kiegszt7
arh 207
acl anyag7
fldbe sllyesztett7
gstermk-elvezet tbb7
gznyoms-szablyoz llomson7
eloszt rendszer7
gznyoms-szablyoz llomst7
vezet nylsainak7
gzfogyaszt kszlknek7
forgalmaz ltal7
s gstermknek7
berendezs s7
megfelelen kell7
kszlk rszeknt7
elrendezs gstermk7
kivezetsre szolgl7
szabvny vagy7
nylsokat gy7
s tmrsgi7
vzszintes elrendezs7
nylsait tartalmaz7
kszlket kiszolgl7
berendezsek s7
gz ramlsi7
htechnikai berendezsek7
helyisgben elhelyezett7
fld alatti7
megengedett mrtk7
kszlkcsere esetn7
az pletben6
rtknek megfelel6
legnagyobb zemi6
gznyoms-szablyozk s6
nyomsszablyoz lloms6
s egyedi6
lloms gpszeti6
kw-nl nagyobb6
kzs gyjt6
helyisgben s6
az azzal6
nagyobb egyttes6
egy helyisgben6
kisebb rtknek6
helyezse 26
ghet anyag6
az pleten6
kell az6
szilrdsgi nyomsprba6
fel kell6
kszlk esetn6
beszvsra szolgl6
ltal megadott6
gstermkt vezet6
nem haladhatja6
fggleges vagy6
vagy vzszintes6
1749 vagy6
pleten kvl6
ki kell6
kvetelmnyek szabvny6
szl rendelet6
kialakulsa nem6
megakadlyozzk hogy6
egy olyan6
telephelyi vezetket6
az automatikus6
fellltsi helyisgen6
kell alkalmazni6
nagyobb mint6
amelyek megakadlyozzk6
ltal megengedett6
gstermk ramoljon6
membrnos lemezhzas6
megfelel smk6
technolgiai rendszerek6
smk egyike6
fellltsi helyisgbl6
egyike szerint6
ne befolysolja6
automatikus zr6
csak akkor6
esetben ha6
nagyobb mret6
tlnyoms elfordulsa6
kln mrhelyisg6
hzi gznyoms-szablyozk6
kell meghatrozni6
c vagy6
kiviteli tervet6
az egyes6
az 566
elhelyezni s6
elzr szerelvnyt6
ramlsbiztostt nem6
kszlkek gstermk6
b22 tpus6
tartalmaz gzfogyaszt6
nem tartalmaz6
hasad-nyl fellet5
berendezsei szabvny5
tlnyomsok kzl5
teleptett gzfogyaszt5
biztonsgi kvetelmnyei5
kszlkek helyisgnek5
rzkel s5
rsban megbzott5
kapcsolatos sajtos5
az e5
lt mop5
vagy tbb5
mrtk tlnyomsok5
kszlk leveg5
az adott5
elzr szerelvnyek5
ne legyen5
villamos berendezsek5
pleten belli5
megfelelnek e5
fggleges pletszerkezeti5
zrt tr5
s biztonsgi5
kell tervezni5
be- s5
kszlk szabadba5
kivitelezsre alkalmasnak5
elszv ventiltor5
hzi gznyoms-szablyoz5
elleni vdelemmel5
vizsglat sorn5
mszaki elrsok5
zrt llapotban5
elrasztsi zna5
gstermknek elvezetsre5
nem megfelel5
kszlkek gstermknek5
rendszer gstermk-elvezetbl5
kszlk helyisgnek5
elhelyezsnek sajtos5
alatt ll5
hatsa alatt5
szemrevtelezssel kell5
szabvny szerint5
fltt kell5
legfeljebb 1405
kszlk elzr5
olyan gzfogyaszt5
mrtk tlnyoms5
rendelkezsre ll5
05 m-nl5
lemezhzas gzmr5
gzfogyaszt kszlkeknl5
gstermknek kivezetsre5
16 bar5
szakaszban tlnyoms5
kikapcsolt kszenlti5
fellltsi helyisgnek5
rendszer gstermket5
kszlket egy5
kzs rendszer5
zr szerelvny5
szolgl kivezetse5
szabadon szerelt5
gy hogy5
kell vezetni5
helyisgen tvezet5
csatlakozvezetk felhasznli5
gstermkt elvezet5
ms helyisgekbe5
terletileg illetkes5
zemi szellztet5
szolgltat vagy5
gyrtja s5
terhelsi llapotban5
egy termszetes5
brk szerint5
nem csatlakoztathat5
s egyb5
biztonsgi elrsokat5
rszt kpezze5
rendszer rszt5
egy eloszt5
s ms5
gstermk-elvezet egy5
az gstermket5
amelyben tlnyoms5
gstermk kivezets5
kszlk csak5
azt az5
az j5
biztonsgi szablyzat5
esetben az5
szomszdos pletek5
nem rendelkez5
egy fggleges5
fellltsi helyisgbe5
elvezet szakaszaiban5
rendelet 15
szabvny elrsainak5
az gstermk-elvezetben5
fggleges elrendezsben5
als brarsznek5
egymshoz kpest5
c12 tpus5
1 mellklet5
vdelmt biztostani5
kiviteli tervtl5
kiraml gstermk5
rszeknt tanstott5
tet felett5
tet fltt5
gz nyomsnak5
meg az5
akkor ezeket5
b3 tpus5
fogyaszti vezetkbe5
gstermk-elvezet gyrtja5
s ramlstechnikai5
utni ventiltort5
plet homlokzatn5
az arh5
140 kw-nl5
eltti ventiltort5
felhasznlsi hely5
egy kzs5
legalbb 105
kszlk teleptsnek4
ventiltorral rendelkez4
azonos pletskon4
tervezse sorn4
teleptsnek tervezse4
c15 tpus4
telepts sorn4
lgtern tvezet4
akns kivitel4
az otsz4
helyezs eltti4
gpszeti berendezseket4
az akna4
kls hatrol4
az lloms4
tpus termszetes4
szolgl helyisg4
c13 tpus4
fels brarsznek4
lloms esetben4
levegt vezet4
tvezet gstermket4
d bra4
nyomsnak szablyozsra4
kzs hasznlat4
kell megvlasztani4
megvlasztani hogy4
nem megengedett4
amelynek tbb4
figyelembevtelvel kell4
kiviteltl fggen4
lefvat vezetk4
kszlk nem4
technolgiai rendszert4
szabvnynak megfelel4
ismtelt zembe4
hatlya alatt4
kialakul tlnyoms4
gstermk elvezetse4
tlnyoms rtke4
15287-2 gstermk4
gstermk elvezet4
elvezet berendezsek4
c5 c74
biztonsgi szempontbl4
70 kw4
c11 tpus4
gzfogyaszt kszlktl4
kvetelmnyei s4
ezekkel legalbb4
pont kvetelmnyeinek4
villamos hlzati4
figyelembe vve4
tpus kszlk4
gzkoncentrci rzkel4
felett vagy4
nyitott gster4
zemel gzfogyaszt4
kszlkek esetn4
ramlstechnikai mretezsi4
msodik indexben4
gzfogyaszt kszlken4
szmtssal kell4
lgterben egy4
ipari s4
c bra4
kpezze amely4
el amely4
akkor helyezhet4
elltott ramlsbiztostt4
brk als4
rendszer leveg-bevezett4
kell ltesteni4
az 534
gstermk-elvezethz amelyben4
berendezsek h-4
kszlkhez mellkelt4
helyezhetk el4
hajlkony vezetk4
nlkli gzfogyaszt4
7 b4
b5 tpus4
hozott rendszer4
gstermk-elvezetbl gstermk4
helyisgekben teleptend4
kszlkek fellltsi4
csatlakoz gzfogyaszt4
jratban kell4
megfelel mrtk4
brk fels4
sorn biztostani4
az egyedi4
mszaki kvetelmnyek4
kszlk tbb4
norml zemi4
terveznek meg4
elrsainak vagy4
gzellt rendszerek4
s rztvzetek4
rz s4
tartalmaznia kellanbspa4
leveg be-4
vezetk trszint4
mechanikai s4
szerelsi nyilatkozat4
s kivezetsre4
robbans elleni4
tblzatban megadott4
ezzel egyenrtk4
gznyoms-szablyoz s4
lloms zembe4
m lehet4
amely az4
bemen nyoms4
megvalsulsi dokumentci4
rendelkeznie kell4
trszint alatt4
betartsval kell4
pontban foglaltak4
25 bar4
elltsban alkalmazott4
tervet kszt4
s alakjt4
helyisgbe vagy4
lennie az4
szabvny szerinti4
szablyairl szl4
alkalmasnak minstett4
ghet gz4
50 m4
otsz szerinti4
pb-gz elltsban4
alkalmazsa esetn4
levegvel alkotott4
terv mszaki-biztonsgi4
lefvat szelep4
kell vgezni4
elhelyezs esetn4
vagy fogyaszti4
kiviteli tervnek4
munkt vgz4
kell lennievissza4
zemen kvl4
nem ghet4
illetkes fldgzeloszt4
vagy egyb4
elhelyezett gzfogyaszt4
belertve az4
hegesztsi felels4
ltal meghatrozott4
pletbe trtn4
fogyaszti felzr4
vgz gzszerel4
kell ha4
gzmr s4
pe anyag4
az ilyen4
lehet nagyobb4
pb-gz zem4
13 itm4
legalbb 054
felhasznli berendezsek4
vagy ezzel4
kialaktani hogy4
100 m3h4
haladhatja meg4
azok megfelelnek4
vezetk nyomvonalt4
cskkentett teljestmnnyel3
kszenlti llapot3
gznyoms-szablyoz gzmr3
leveg bevezets3
t gstermk3
olyan rszei3
kszlken t3
gstermk-elvezet kitorkollst3
helye tpusa3
rszei amelyek3
kell betartani3
llapot vagy3
teljestmnnyel zemel3
rendszer gstermk-elvezet3
rtket amelyet3
gstermk-elvezetbl csak3
kikapcsolt llapott3
az rtket3
meg azt3
haladja meg3
brmely terhelsi3
ne haladja3
nincsenek olyan3
szolgl kzs3
llapotban idertve3
elvezetsre szolgl3
elvezetse tbb3
kszlkcsere kivtelvel3
gstermk-elvezethz csatlakoztathatk3
tzelstechnikai alkalmazsa3
helyisgeibe vagy3
fellltsi helyisgeibe3
kezelni kpesa3
ramoljon gzfogyaszt3
kzs gstermk-elvezetbl3
olyan rszegysgeket3
kszlk brmely3
amely olyan3
csatlakoztathatk amely3
rtke ne3
teljestmny membrnos3
amelyeknek nincsenek3
elrendezsi sma3
mszaki megoldst3
meg hogy3
legalbb 13
estben ha3
az estben3
alatt az3
gyjt- vagy3
kzs gyjt-3
plet kls3
kell vlasztani3
tervezni s3
kivitelezst vgz3
vezetk nyomvonalnak3
nvleges zemi3
ha azt3
kell rgzteni3
kszlk konstrukcis3
specilis elrsoka3
vonatkoz specilis3
kszlk teleptsre3
kls falra3
tpus centr3
kszlk olyan3
hhats elleni3
elleni vdelmt3
az brn3
1749 szabvnyban3
korrzivdelemmel kell3
tblzat szerinti3
helyisg lgternek3
kszlkek amelyeknek3
megfelel sma3
11 c3
foglaltak alapjn3
terveznek kell3
nyomvonalt gy3
ez nem3
elrendezsnek megfelelen3
tlnyoms alatt3
nem ll3
tpus ramlsbiztostt3
tpust s3
biztostsval kell3
kszlk gsi3
trszint felett3
egyedileg kell3
tartozkainak vdtvolsgt3
d vagy3
b14 tpus3
kell meghatroznia3
7 c3
vezetkek biztonsgi3
kszre szerelt3
vdtvolsgon bell3
b1 tpus3
vezetk nem3
tereit hatrol3
vezet tereit3
bell az3
rszeknt forgalomba3
felhasznlsi helyen3
gstermk kivezetsre3
helyisg falnl3
gyakorlshoz szksges3
rendszerekre vonatkoz3
beptsre vonatkoz3
s gzmr3
kell elzr3
tipus kszlkek3
kivezetsre vonatkoz3
lgterben csatlakoz3
levegt egy3
gstermk kivezet3
sszes nvleges3
hasznlaton kvl3
vagy jogi3
szervezet amely3
ltal kiadott3
get 33
elhelyezsnek ltalnos3
3 373
37 pontjban3
pontjban meghatrozott3
meghatrozott gzfogyaszt3
kszlk amely3
helyisgbl nyeri3
helyisg lgtern3
s gstermkt3
egy gzfogyaszt3
leveg-bevezethz s3
kzvetlenl vagy3
gstermk-elvezetn keresztl3
mellkelt dokumentcijban3
kszlkcsere bizonylaton3
teleptett folyamatvezrl3
elfordulsa megengedett3
s nyomsviszonyok3
elgsgesen kzel3
szempontbl egyenrtk3
vonatkoz mszaki3
zembe ha3
helyezhet zembe3
elrt szerelsi3
zembe helyez3
zemi nyomson3
gz csatlakozvezetkek3
zemi nyomsa3
vezetk zemi3
vagy fggleges3
vzszintes vagy3
fggen vzszintes3
nylsok elhelyezse3
egymshoz elgsgesen3
megengedett az3
kvetelmnyei 82113
kialaktstl fggen3
53 b3
csatlakoztatni az3
anyag vezetkek3
sajtos kvetelmnyek3
vezetk rejtett3
rendszer fggleges3
hasznlt jrat3
vezetk pleten3
jratban helyezkedjen3
helyezkedjen el3
egy korbban3
korbban gstermk-elvezetknt3
gstermk-elvezetknt hasznlt3
nyomsviszonyok hatsa3
zeme sorn3
mkd gyjt3
ptsggyel sszefgg3
ll robbankpes3
robbankpes lgtr3
sorn vltoztathat3
egy vagy3
s gstermket3
fm anyag3
ennek sorn3
rszletes szablyairl3
gstermk-elvezet berendezseinek3
megfelel az3
az ptsgyi3
ptsgyi s3
homlokzaton kell3
az ptsggyel3
sszefgg szakmagyakorlsi3
alkotott keverkbl3
tanstvnya szerinti3
tartalmaznia kell3
kivitelezett csatlakozvezetk3
mkd gzfogyaszt3
gstermk elvezetsnek3
tervtl val3
zembe helyezsre3
szabadban kell3
szakmagyakorlsi tevkenysgekrl3
kszlk gstermk-elvezethz3
s gznyoms-szablyoz3
vagy hasznlati3
vezetk vagy3
szempontbl trtn3
tevkenysgekrl szl3
keverkbl ll3
aeroszolok levegvel3
szl miniszteri3
csatlakozsi nyoms3
c5 tpus3
mszaki megoldsnak3
fogyaszti vezetken3
ltal ksztett3
van s3
az egy3
vzszintes elrendezsben3
kszlkek s3
kszlk helyisgbe3
fellvizsglt s3
ltal mszaki-biztonsgi3
gzfogyaszt kszlkre3
fggetlenl forgalomba3
kszlktl fggetlenl3
kell csatlakozatni3
kdk aeroszolok3
tvolsgban helyezhetk3
vagy kdk3
robbankpes gzkzeg3
s karbantartsi3
feltteleknek megfelel3
ekknt meghatrozott3
vltoztathat tvolsgban3
pontjban ekknt3
vezet rszeivel3
csatlakozvezetket fogyaszti3
100 mbar3
az elrt3
minsljenek ez3
kszlk tpus3
c33 tpus3
szerelt llapotban3
csak abban3
tanstott s3
gzipari engedlyes3
elleni vdelem3
kell elltni3
robbankpes kzegek3
fels szintje3
sszekttetsben lv3
illetkes gzipari3
eredmnyez melynek3
elrsai alapjn3
znt eredmnyez3
telepts tervn3
kszlk zembe3
ellenrizni kell3
1-es znt3
gyermekek tanulk3
kros hhats3
1400 kw3
htgulsi lefvat3
robbansveszlyes zna3
nvleges teljestmnynl3
teljestmnynl nagyobb3
nagyobb gzmr3
padlszint alatt3
illetve padlszint3
tr- illetve3
elhelyezsre akkor3
kw egysg-hterhels3
gzfogyaszt kszlkkel3
kszlkkel azonos3
azonos helyisgben3
kln mrhelyisget3
feleljenek meg3
megfelelsgi jellssel3
ce megfelelsgi3
gyrt elrsa3
szerelt gzfogyaszt3
gzmr nem3
b44 b523
ltalnos kvetelmnyek3
b14 b223
b22 b233
b23 b323
b32 b333
b33 b443
b52 b53nbsptpus3
b13 b213
b53nbsptpus gzfogyaszt3
zemt nem3
kszlk zemvel3
legalbb 53
j hegesztsi3
vgni s3
azzal legalbb3
b12 b133
helyisgben lv3
m-nl kisebb3
mkdshez szksges3
szolgl s3
az idszakos3
zr szerelvnnyel3
rendszer rsze3
gpi elszv3
kszlk oldalelemnek3
b11 b123
oldalelemnek magassgt3
meg nem3
nem halad3
btor esetben3
05 m3
sztatikus feltltdsek3
szilrdsgi s3
m3h nvleges3
alatt lv3
az gstermk-elvezethz3
csak az3
tvolsgra kell3
szabadba kell3
gznyoms-szablyoz llomsnak3
az els3
szablyozott oldali3
tervben elrt3
bell csak3
rintettsge esetn3
robbansbiztos kivitel3
villamos berendezs3
talajszint fltt3
megfelel megoldsokat3
2-es znba3
megfelelnek kell3
als le3
fldgzeloszt telephelyi3
llomst gy3
belli hatrol3
legfeljebb kzpnyoms3
kzpnyoms hzi3
nvleges teljestmny3
vdelemmel kell3
csatlakozvezetkben mszaki3
rendszerek gznyoms-szablyozk3
12279 gzellt3
nyomsprba s3
elhelyezett gznyoms-szablyoz3
vzszintes vetletben3
gyorszr s3
ez az3
kell biztostani3
pletben elhelyezett3
rendszer s3
kell szerelni3
mrett s3
szerkezetileg s3
az gsi-3
gsi- s3
tmrsgi prbnak3
prbnak kell3
elrsok szerint3
kibocst forrsok3
norml zemben3
helyisg szellz3
nyitott vagy3
az elrasztsi3
zemi llapotban3
bra alapjn3
mkds szempontjbl3
s mkds3
als lnek3
vagy zrt3
szabadbl nyl3
szellznylsa kivezetsnl3
legalbb 153
elleni vdelmet3
legalbb 503
lefvat szellznylsa3
elprologtat berendezs3
szablyozsra szolgl3
az elprologtat3
srsg gz3
nyl vgn3
vagy rcs3
08 m3
kivitel gznyoms-szablyoz3
huzalhl vagy3
zsalu huzalhl3
kivitel ipari3
legfeljebb 153
nylt gster3
tzelanyaggal zemel3
kellszme-g 202004173
kszlk gstermknek3
nagyobb s3
ramlsbiztost nlkli3
egszsggyi s3
elvezetsvel kapcsolatos3
gstermk-elvezet egyttest3
varrat nlkli3
s csidom3
mretezsi eljrs3
gstermk kivezetsnek3
tet feletti3
mszaki elrs3
ne jelentsen3
jelentsen veszlyt3
veszlyt az3
azok e3
mm cstmr3
gstermk az3
szempontbl kifogstalan3
vezrelt vszszellztet3
egy fogyaszti3
hossza legfeljebb3
kvl helyezett3
szolgl helyisgek3
minstett kiviteli3
elltott vagy3
hegesztett ktssel3
vagy ezekkel3
ltal kivlasztott3
szellz leveg3
felszerelt gzfogyaszt3
bar zemi3
kszlk biztonsgos3
13384-1 gstermk-elvezet3
ne veszlyeztesse3
15287-1 gstermk-elvezet3
s azzal3
arh 403
az acl3
helyezs eltt3
gyjt szakaszban3
lennie s3
az olyan3
le kell3
beszv s3
zembe helyezst3
kell felszerelni3
elhelyezni ha3
relatv srsg3
nagyobb relatv3
tlnyoms alakulhat3
alakulhat ki3
gstermk-elvezet minstse3
az ingatlan3
helyezse 13
kivezetssel rendelkez3
rsz nyitott3
berendezsei szabvnynak3
szlnyoms szempontjbl3
pletek szerkezetek3
szerkezetek akadlyok3
homlokzati kivezetssel3
befolysolja htrnyosan3
kszlk gyrtjnak3
c1 c33
c3 c53
meghatrozottak szerint3
c7 c93
c9 c113
c11 c133
c13 c143
azzal vezrelt3
kszlkkel s3
gstermk tmegram3
hegeszt nevt3
tpus egy3
helyisgben legfeljebb3
keltt s3
szmt keltt3
hegeszt tanstvnynak3
nevt azonost3
alkalmazott hegesztsi3
varrat azonost3
anyagminsgt s3
idom anyagminsgt3
vagy idom3
cs vagy3
megnevezst cs3
alapanyag megnevezst3
llapotban van3
azonost sorszmt3
hegesztberendezs tpust3
kialaktsa szerint3
az sszenyitott3
berendezsek zemt3
kell vgni3
hegesztsi varratok3
j gzfogyaszt3
s ramlstani3
cm2 szabad3
varratok szemrevtelezses3
s mrett3
vgzk s3
hegesztst vgzk3
vgzett javtsok3
varraton vgzett3
ellenrzsnek eredmnyt3
szemrevtelezses ellenrzsnek3
tpust azonost3
megnevezst azonost3
beavatkoz kszlkkel3
2 db3
kell hegesztsi3
berendezsek 23
rendszerek biztonsgi3
vagy egyttmkd3
kivitelezjnek rendelkeznie3
hegeszts kivitelezjnek3
25-nl nagyobb3
berendezsek ltalnos3
hlzati csatlakozssal3
csatlakozssal rendelkez3
robbansi helyzet3
helyzet hatsai3
hatsai elleni3
anyag csatlakozvezetk3
hegesztsi felelssel3
felelssel valamint3
vezetk megnevezst3
helyszni irnytsval3
gstermk kivezetst3
kivezetst gy3
naplnak tartalmaznia3
hegesztsi naplnak3
nemzeti szabvny3
irnytsval rsban3
keletkez kondenztum3
hegesztsi tevkenysg3
figyelembe kell3
kell venni3
tevkenysg helyszni3
teljestik e3
el nem3
nem zrhat3
folykony tzelanyaggal3
hivatkozssal forgalomba3
s732
gzfogyaszt725
az661
kell588
vagy404
kszlk369
tpus331
nem215
vezetk164
megfelel140
gznyoms-szablyoz127
ha126
kszlka116
kszlket115
szerinti113
hogy110
telephelyi107
fogyaszti105
gstermk-elvezet102
gstermk101
kszlkek99
mszaki99
bra88
egy87
csatlakozvezetk86
szolgl85
esetn85
legalbb82
rendszer81
elrendezsben80
szerint77
ltal76
biztonsgi74
gy73
akkor73
esetben72
vonatkoz70
berendezsek68
csak64
tztr64
olyan62
b62
lloms60
elltott59
fellltsi59
pb-gz58
meg56
ipari56
el55
msz55
tervez54
amely54
gz53
ventiltorral53
gstermk-elvezethz52
nagyobb50
tartalmaz50
helyisg50
smnak50
vezet50
helyisgben47
tartalomjegyzkhez47
sorn45
leveg45
elhelyezni45
valamint44
zembe44
kiviteli44
ms43
szksges43
trtn42
lv42
zemi42
fggleges42
szabadba41
berendezs41
rendelkez40
technolgiai40
hegesztsi40
nyoms40
villamos40
c39
legfeljebb38
lehet38
elzr38
gzmr38
037
biztostani37
azonos37
alatt37
termszetes37
meghatrozott36
mkd35
als35
terveznek35
alapjn35
tlnyoms35
135
szabvny34
kzs34
bar34
plet33
elhelyezett33
ne33
233
rsz33
zrt33
szolgltat33
gyjt32
gyrt32
azzal31
legyen31
felhasznli31
val30
kls30
tbb30
egyenrtk30
leveg-bevezet29
pleten28
gstermket28
lefvat28
fels28
eltti28
elvn28
szl27
eltt27
utni27
bell27
egyttes27
327
kvetelmnyek27
megengedett26
gsi26
annak26
elrendezs25
m25
brarsze25
lennie25
elleni25
kvetelmnyei24
helyezhet24
anyag24
van24
azok24
smk24
gzfelhasznl24
kzvetlenl24
kilpsre24
zr24
nvleges24
mszaki-biztonsgi24
vzszintes23
ghet23
alkalmazott23
amelynek23
huzat23
pontban23
megadott23
tmrsgi23
szerelvny23
sajtos23
gyrtja22
csatlakoz22
hterhels22
e22
felett22
alatti22
tekinteni22
vezetkes21
elhelyezse21
egyedi21
helyisgnek21
egyb21
trszint21
kszlkcsere21
llapotban21
mechanikai21
egyiknek20
elrt20
vezetket20
zemel20
trbe20
fldgzeloszt20
rendelet20
kszlkhez20
kvl20
ll20
kvetkez20
kztt20
levegt20
szerelvnyek20
420
tanstott19
szerelt19
szempontbl19
meglv19
kw19
tervezsi19
forgalmaz19
pont19
szabad19
elhelyezked18
vezetkek18
nyomsprba18
amelyek18
alkalmas18
terv18
gster18
engedlyes18
lgnyoms18
brk17
megfelelen17
ez17
szilrdsgi17
illetve17
kln17
kivezetettnek17
tartzkodsra17
utn17
ltalnos17
azonost17
tervezett17
egyszerstett17
gstermknek17
teleptse17
kisebb17
nyomsszablyoz17
rendszerek16
gztrol16
terleti16
tet16
kivezetsre16
tzelberendezsek16
robbankpes16
szerelsi16
szellz16
helyezse16
abban16
anyagok15
515
forgalomba15
0515
elhelyezsnek15
feleljen15
rendelkezsre15
elhelyezsre15
azt15
vizsglat15
beszvsra15
tervben15
615
ventiltort15
pletben15
legnagyobb15
felttelek15
hzi15
kzponti15
tervezse15
zna15
robbansveszlyes14
nlkli14
nyl14
keresztl14
biztostania14
beptett14
telepts14
llomsok14
feletti14
kivezetst14
telepteni14
rszt14
gpszeti14
kpest14
kivitel14
szabadban14
varrat14
ki14
gstermkt14
teleptsi13
bepteni13
elrsainak13
huzamos13
teljestmny13
713
hegeszt13
813
fel13
megoldsokat13
acl13
koncentrikus13
minden13
helyt13
megfelelnek13
pletszerkezeti13
lgtr-sszekttetsben13
helyisgbe13
hozott13
913
teljes13
gznyoms-szablyozk13
fggen13
figyelembevtelvel12
mdon12
j12
gyrti12
1012
beavatkoz12
hatrol12
nylsokat12
berendezsei12
1112
1212
csatlakoztatni12
kzl12
kztti12
elvezets12
biztonsgos12
nyilatkozat12
homlokzati12
helyisgek12
elvezet12
tovbb12
amelyben12
emberi12
automatikus12
cs12
mellett12
kveten12
1312
mrtk12
eltr12
1412
rszeknt12
helyisgekben12
dn12
rsban12
bels12
1512
ahol12
nyitott11
szakaszban11
tblzat11
szempontjbl11
mrett11
ramlsi11
valamennyi11
gzszerel11
berendezseket11
tvezet11
nylsok11
pletbe11
fm11
teleptenivissza11
kivitelezse11
1611
fltt11
gpi11
norml11
helyezs11
vgz11
al11
arh11
1711
teleptett11
mret11
megolds11
pe11
hasad-nyl11
szabadbl11
szellzs11
alkalmazsa11
1811
szerelvnyt11
lgellts11
megtervezni11
foglaltak11
helyisgbl11
hegesztett10
szme-g10
1910
alkalmazhat10
d10
figyelembe10
nylsainak10
kzvetlen10
tartoz10
kiszolgl10
tpusa10
lgterben10
2010
nincs10
teleptsre10
tpust10
elhelyezs10
nylsait10
mr10
centr10
felhasznlsi10
helyszni10
kiegszt10
kivve10
hegeszts10
elrsok10
tztrhuzat10
rintett10
mm10
kapcsolatos10
berendezst10
egyes10
szellztet10
szabvnyban10
tblzatban10
kros10
mellklet10
2-es10
rszei10
kzpnyoms10
hegesztst10
ellenrizni9
alkalmazni9
helyisgen9
nyomsnak9
vdelmt9
helye9
cl9
ad9
szemrevtelezssel9
megfelelsgt9
egymshoz9
219
rsze9
biztost9
megnevezst9
tartalmaznia9
elszv9
h-9
b229
kikapcsolt9
gstermk-elvezetbl9
alkalmasnak9
csatlakoztathat9
prba9
ilyen9
korm9
pletek9
figyelemmel9
berendezseinek9
helyen9
zemt9
fld9
kivezets9
llapot9
kibocst9
oldali9
szemly9
brarsznek9
szabvnynak9
kialaktani9
rtke9
zem9
zeme9
le9
fldbe9
elrsai9
szomszdos9
szakgi8
kteles8
szemben8
szablyzat8
jratban8
tvolsg8
elektromos8
brn8
mint8
szakaszaiban8
c118
ennek8
kialakulsa8
228
szabadon8
sma8
szerkezeti8
gstermk-elvezetben8
c138
kw-nl8
mrhelyisg8
hegesztk8
nyomst8
tzvdelmi8
fggetlen8
llomst8
rtknek8
gznyoms8
csvezetk8
rtket8
msodik8
csatlakozsi8
kszlknek8
hely8
mrt8
eloszt8
tervet8
kivitelez8
fellet8
pontjban8
kialaktott8
csatlakozvezetket8
egymstl8
gzzal8
hasznlt8
kvetelmnyeknek8
kzi8
varratok8
eurpai8
elrs7
belertve7
kizrlag7
belps7
azonostott7
gzmrk7
vizsglati7
237
fokozat7
jogi7
brmely7
gzkoncentrci7
kezelsi7
adott7
biztostja7
kivitelezst7
zrhat7
rint7
erre7
csatlakozvezetkek7
rszeit7
befolysolja7
vdelemmel7
szmt7
lemezhzas7
nlkl7
megvalsulsi7
hatrozza7
kszlkkel7
hajlkony7
kivitelezsre7
csatlakozs7
illetkes7
bemen7
szerelvnyeket7
247
kapcsold7
kvetkezk7
sllyesztett7
ezek7
kivezet7
m3h7
szivatty7
melynek7
ramlsbiztostt7
kt7
llomson7
amelyet7
vdelem7
ezt7
kts7
mkdst7
minsljenek7
kvetelmnyeinek7
c57
amennyiben7
lgelltsi7
vezetkbe7
szerkezetek7
htechnikai7
krnyezetben7
mop7
257
lthat7
nyithat6
egyike6
teleptsnek6
betartsval6
rendszert6
vrhat6
rtk6
ellen6
gyorszr6
akns6
konstrukcis6
magassga6
majd6
trgy6
btor6
b146
266
tvolsgban6
hasznlat6
tr6
akna6
nagy-kzpnyoms6
nylsai6
egyidejleg6
kialaktsa6
ce6
rzkel6
jl6
elfordulsa6
iec6
szelep6
vgn6
feszltsg6
ezeket6
kivezetsnek6
rz6
ellt6
db6
b46
egszsggyi6
276
vizsglt6
javtsok6
kiraml6
b36
iso6
rendelkeznie6
c36
falra6
teleptend6
fal6
membrnos6
meghatrozni6
286
vgezni6
ventiltor6
tlnyomsok6
vezetni6
megakadlyozzk6
vezetknek6
ramoljon6
felhasznl6
kszenlti6
c126
haladhatja6
tervezni6
idom6
elvezetsre6
15287-26
vdeni6
t6
c96
c76
kilp6
m-nl6
tvolsgra6
gyrtjnak6
feltntetett6
vezetken6
mkdsi6
lgternek6
kerl6
nyomshatrol6
lgtr6
kivezetsek6
1-es6
szerkezet6
llapott6
csatlakozvezetkbe6
elrsnak6
eljrs6
kiadott6
elemek6
berendezssel6
vdtvolsg6
296
belli6
lgtrben6
elrsokat6
dokumentci6
vgzett6
nyomsa6
fldgz6
tevkenysgek6
kivitelezett6
zemeltetsi6
ltestmny6
helyrajzi6
otsz6
osztlyba6
sszes6
arra6
robbansi6
ismtelt6
egyidej6
vii5
gzelltst5
szablyoz5
felhasznlt5
vdtvolsgok5
aclcs5
ezzel5
fggetlenl5
megfelelsget5
lehetsges5
mennyisg5
305
folykony5
rszletes5
helyisgekbe5
fajlagos5
vltoztathat5
elhelyezve5
azon5
pince5
reteszelt5
foglalt5
nylt5
clra5
felszerelt5
felszerelni5
tervnek5
teljestmnynyilatkozattal5
lgtern5
rszre5
gznyoms-szablyozrl5
045
srsg5
kivlasztott5
kialaktsra5
cscsfedez5
eu-megfelelsgi5
egyik5
veszlyt5
minstse5
kialakul5
mbar5
robbans5
lt5
be-5
szintetikus5
315
mkds5
g5
b55
homlokzatn5
ramlsbiztost5
tartozkok5
htrnyosan5
c45
alakjt5
feltteleknek5
c145
roncsolsmentes5
szmra5
csatlakozvezetkben5
folyadkfzis5
mretezs5
tmegram5
levegvel5
megbzott5
325
minstett5
beptsre5
amelyen5
szellznyls5
korltozott5
fl5
kszlktl5
aclcsvek5
terhelsi5
ezekkel5
csatlakozik5
els5
idertve5
kivezetse5
mretezsi5
kszlt5
primer5
egytt5
335
ptett5
munkt5
szm5
felhasznlnak5
kszlkeknl5
a15
szekunder5
indexben5
szablyozott5
szablyairl5
robbansbiztos5
biztonsgtechnikai5
b325
jrat5
ellenrzst5
ellenrztt5
b335
b445
b525
helyezst5
kpezze5
vezetkhez5
b235
legyenek5
elrasztsi5
szmtssal5
hatsa5
b15
b25
csatlakozvezetknek5
kivitelben5
tzelanyaggal5
mdostsa5
ltesteni5
nyomvonalt5
beptsvel5
mellkelt5
345
szakasza5
kivtelvel5
rvnyes5
szmtott5
rintsvdelmi5
b115
b125
csvezetkek5
b135
elvezetse5
egyetlen5
b215
specilis5
tpusnak5
kzelben5
hasad5
355
kitorkolls5
tlnyomsos5
vdtvolsgt5
szigetel5
kivtel5
leveg-bevezett5
kialaktsnak5
megfelelsgi5
ramlstechnikai5
terletileg5
igazol5
szervezet5
keletkez5
technolgia5
rgzteni5
folyamatos5
szilrd5
kifejezetten5
mreteit5
tervtl5
trtnt5
gt4
vdelmet4
vszszellz4
biztostott4
kedveztlen4
014
vve4
felszni4
364
zemeltet4
nylst4
elprologtat4
b414
egyttmkd4
kockzati4
esetleges4
rtkt4
b424
tervn4
b434
lakossgi4
gyrtmvi4
tpusok4
gstermk-elvezetn4
idszakos4
se4
oldalelemnek4
karbantartsi4
vezeti4
vonal4
vezrelt4
htgulsi4
lersban4
elrsa4
vezetkben4
mternl4
orszg4
elvgzett4
meghalad4
eredmnyez4
megvlasztani4
60079-10-14
szlnyoms4
kvnt4
kszlkekhez4
mezgazdasgi4
rszeinek4
ahhoz4
znk4
melyek4
elhelyezsi4
padlszint4
orszgos4
helyisggel4
egyttesen4
hterhelse4
belltsi4
kifogstalan4
kszlken4
tmrsgvizsglat4
fellettel4
mszert4
mretezett4
vegyes4
oldhat4
belsejben4
trben4
cljra4
szellzcs4
megvalsult4
feljogostott4
kszt4
tartalmazza4
nyilatkozata4
szksg4
szabadtri4
vszszellztet4
helyezhetk4
trfogatram4
sszenyitott4
fellvizsglt4
alakulhat4
feladata4
374
lljon4
ramlsbiztostval4
szabvnyossgi4
helyezkednek4
minimlis4
kzel4
kz4
kapcsolatban4
mely4
tzelstechnikai4
klnll4
nyomsklnbsg4
felttelekkel4
h4
szekrnyben4
levegellt4
lehetv4
sszekttetsben4
szellzleveg-trfogatram4
feltteleinek4
szablyozsra4
lgelltst4
amellyel4
hlzati4
helyisge4
384
csvezetket4
berendezsnek4
azokkal4
jelen4
mind4
zemen4
c84
vetletben4
kapillrisan4
feleljenek4
megoldst4
rszeivel4
legkisebb4
c104
prbazem4
szakaszt4
talajszint4
szempontok4
felzr4
r4
394
elrendezsi4
404
zemeltetshez4
alapanyag4
414
vgezhet4
tervezs4
424
ltestmnyek4
minsl4
egyedileg4
mm-nl4
lennievissza4
terleten4
leveg-bevezethz4
ingatlan4
trtnik4
rsznek4
vdcsbe4
vz4
eltrs4
sztatikus4
zemeltetse4
434
ktst4
444
fali4
kiviteltl4
elrendezsnek4
c634
meghatrozottak4
c1024
ktsek4
korrzi4
igazolt4
zemzavar4
c154
nincsenek4
kemny4
hasznlati4
prsidomos4
rztvzetek4
karbantarts4
jegyzknyvben4
a24
hre4
hatsok4
szerelse4
kellanbspa4
hegesztsirnyt4
felels4
nyomson4
magassgt4
gzipari4
rejtett4
helyez4
hhats4
kivitelezs4
v4
tervezhet4
sem4
vizsglatt4
eu4
rszegysgeket4
tilos4
elltni4
albbi4
szabvnyok4
tervezi4
elltsban4
c14
gzellt4
gmbsz4
c64
vizsglatot4
burkolat4
454
kibocstsi4
-a4
pletskon4
keverkbl4
alkotott4
nemzeti4
itm4
helyezsre4
korbban4
feltteleit4
eredmnyt4
jogosult4
kondenztum4
combustion4
dokumentcijban4
csatlakoztathatk4
gstermk-elvezetre4
ellenrzsnek4
tanstvnynak4
kvet4
hatlya4
kialaktsval4
vizsglatnak4
lershoz3
nyomsviszonyok3
vi3
hasznlaton3
megfelelsg3
engedllyel3
elrsait3
amelyeket3
gstermk-elvezett3
magyar3
ltalban3
energetikai3
skja3
teleptst3
leveg-bevezetknt3
kialaktstl3
nyeri3
szellztets3
reteszelni3
helyezkedjen3
gstermk-elvezetknt3
elgsgesen3
sikeres3
b53nbsptpus3
jegyzknyvet3
tmrsgt3
mszerrel3
gztrolk3
olajgt3
blokkrendszer3
halad3
gztrolt3
tartalma3
463
korltozsok3
kpes3
tevkenysge3
gyakorlshoz3
473
cm23
igazolnia3
ramlstani3
telepthetk3
c63c333
depresszi3
get3
c623
csatlakoztatott3
c62c1023
hibra3
20200417vissza3
c1033
c1133
zemvel3
csatlakozatni3
ptszeti3
483
elrsoka3
adatokat3
3-as3
13384-13
tartly3
igazolsa3
fekete3
jelzia3
folyadk3
nylsnak3
sszekt3
elvezetst3
lgelltsa3
gztzhely3
tipus3
tztrrel3
gzkszlk3
gyjt-3
zemhez3
estben3
tereit3
llomsra3
a33
kzlt3
gstermk-elvezetbe3
ismtelten3
kivezetssel3
akadlyok3
rvid3
jegyzknyv3
bizonylat3
elemekbl3
tetgerinc3
elhelyezkedse3
15287-13
eljrssal3
elvezetsvel3
dokumentcija3
veszlyeztesse3
c6nbsptpus3
jelentsen3
beszv3
rszhez3
eleme3
cserje3
hivatkozssal3
egyttest3
kttt3
valamelyikvel3
c333
c23
killtott3
riaszt3
jele3
falnl3
csatlakozika3
pletgpszeti3
tmrsg3
homlokzaton3
beptst3
folyamatvezrl3
kszlk-modulja3
tzel-3
forrsainak3
olajgk3
zemeltetett3
tartalmi3
teljestik3
venni3
hatrnl3
mikor3
hegesztsre3
csatlakozssal3
dugs3
493
tnyez3
kszre3
tzelberendezs3
rendszerekre3
kialakthat3
amelyeknek3
503
cskkentett3
teljestmnnyel3
helyisgeibe3
hatsra3
vdelmi3
jel3
vagyc3
kszlk-modul3
meghaladja3
haladja3
tekintend3
kezelni3
hatsai3
kpesa3
helyzet3
arnya3
osztly3
mkdshez3
beptsnek3
adja3
nyilatkozatot3
idomok3
keresztmetszete3
csidom3
aki3
ftsi3
ptsgyi3
ptsi3
lgy3
kv-nl3
513
cstmr3
ktssel3
nyomshatron3
csanyag3
kijellt3
gzinfrastruktra3
idtll3
gztmren3
ersram3
vdcsben3
ellenllnak3
falon3
teret3
passzv3
befogadsra3
korrzivdelem3
jogosultsggal3
tevkenysgekrl3
szakmagyakorlsi3
sszefgg3
ftst3
ptsggyel3
tvzetlen3
kr3
trgyak3
hozaganyag3
kdk3
nevestett3
naplnak3
idtartama3
hegesztberendezs3
anyagminsgt3
krnyezeti3
irnytsval3
nevt3
keltt3
sorszmt3
szemrevtelezses3
varraton3
gyrtmnyok3
vgzk3
aeroszolok3
tevkenysg3
felsorolt3
hossza3
ltestsnek3
karims3
hegesztssel3
vezetkszakasz3
helyezett3
vezetkeinek3
irnyt3
felelssel3
utastsnak3
tevkenysget3
25-nl3
fordulhat3
gzok3
vgezheti3
kivitelezjnek3
vdcs3
zemelst3
elzetesen3
vdtvolsgon3
tovbbi3
tartalmazzk3
biztostsval3
kitorkollst3
meghatroznia3
elhelyezkedsk3
veszlyeztet3
nylszrk3
mretarnyban3
tartozkainak3
nyomscskkenst3
sz3
523
zrjelben3
terek3
kpez3
bevezets3
kvetelmnyeit3
amikor3
kvli3
betartani3
sng3
mrtkt3
idpontjban3
villmvdelmi3
tvezetett3
mretek3
gzvezetk3
mrsi3
023
533
kivitelnek3
jelztblval3
hozzfrhet3
rintsvdelem3
cserjt3
rtknl3
korrzivdelemmel3
tanstvnya3
eu-tpusvizsglati3
miatt3
megfogsi3
biztonsggal3
kzmvek3
vezetkeket3
cmt3
tevkenysgnek3
eredmnyes3
kellszme-g3
543
relatv3
szerels3
gzszivrgs3
adatait3
553
ltestett3
beptsi3
563
kvetelmnyeket3
anyaga3
vlasztani3
belp3
tmeneti3
mretezst3
elvezetsnek3
attl3
gzeloszt3
nyomvonalnak3
lerst3
mretezni3
llandsult3
fbb3
faln3
jelt3
megllaptsa3
veszi3
gondoskodni3
miniszteri3
szltl3
elegend3
ramlik3
tarts3
kszlkbe3
lland3
nmkden3
okoz3
083
rszn3
gztzels3
es3
vegyi3
gzkibocstsi3
nmkd3
sdnbspa3
nyomsprbt3
megoldsnak3
nyitsi3
vannak3
illetktelenek3
ksztett3
padozatnak3
szikrt3
tervezheti3
gzellts3
llomsnak3
m-es3
nylszr3
elrsokon3
oldaln3
kezelhet3
llapotnak3
csatlakozzon3
prbnak3
nylszri3
elrtak3
egysg-hterhels3
gzmrt3
bizonylaton3
lehetsgt3
helyisgn3
szintje3
rendelkezik3
kapcsol3
levegellts3
gyermekek3
tanulk3
trolsra3
telepthet3
elzrt3
elrst3
kzvetett3
ssze3
csatlakozvezetken3
szellzst3
cljbl3
nll3
tri3
forrsok3
zemben3
rtkre3
szintjn3
kombinlt3
mrhelyisget3
573
hozz3
szemlynek3
lnek3
legkzelebbi3
knnyen3
teljestmnynl3
wm33
helyn3
szemlyek3
tr-3
583
kmnysepr-ipari3
jellssel3
ehhez3
tvolsga3
tvolsgnak3
kockzatot3
kzegek3
kialakts3
-nl3
szerkezetileg3
gsi-3
zsalu3
huzalhl3
rcs3
ekknt3
znt3
szellznylsa3
kpestssel3
minsts3
mrtkben3
vgni3
varratot3
hiba3
gzkzeg3
trsg3
nyomsfokoz3
minstsek3
munkinak3
elemei3
minsg3
feltltdsek3
szerelvnnyel3
bezrhat3
zrjon3
kivezetsnl3
elhelyezsnl3
eph3
szerelvnynek3
jr3
kszlkre3
rintettsge3
megbzottja3
idegen3
rb3
nyomsmr3
eszkz3
felhasznlsval3
beszablyozsi3
593
603
kapualjban3
kzlekedsi3
betervezni3
bepthet3
krlmnyek3
lgkri3
zemszer3
vezetkszakaszba3
szerelni3
stp3
mretnek3
znba3
60079-143
maximlis3
vdett3
zemelsre3
magassgban3
ktfokozat3
gznyoms-szablyz3
szablyos3
ideiglenesen3
szellznylst3
pletnek3

Who hosts Gmbsz.hu?

Gmbsz.hu Hosting Provider Information

Hosted IP Address:116.202.134.234
Hosted Hostname:two.muranyi.hu
Service Provider:334,Udyog Vihar
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "334,Udyog Vihar" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
334,Udyog Vihar
0.0850%

HTTP Header Analysis for Gmbsz.hu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 10 May 2021 13:23:31 GMT
Server: Apache
Strict-Transport-Security: max-age=31536000
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Expires: Mon, 10 May 2021 14:23:31 GMT
Content-Encoding: gzip
Vary: Accept-Encoding
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Mon, 10 May 2021 13:23:31 GMT
Referrer-Policy:
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Gmbsz.hu Domain Nameserver Information

HostIP AddressCountry
helium.ns.hetzner.de 193.47.99.5
oxygen.ns.hetzner.com 88.198.229.192
hydrogen.ns.hetzner.com 213.133.100.98


Need to find out who hosts Gmbsz.hu?


Domain Registration (WhoIs) information for Gmbsz.hu

 % Whois server 3.0 serving the hu ccTLD

domain: gmbsz.hu
record created: 2006-07-07 23:12:27
Tovabbi adatokert ld.:
https://www.domain.hu/domain-kereses/
For further data see:
https://www.domain.hu/domain-search/

Websites with Similar Names

Gmbsz.hu
gmbsz.hu – Gázipari szabályozás, legyen annak a neve GOMBSZ GMBSZ MBSZ vagy a 3/2020. (I. 13.) ITM-rendelet 1.sz. melléklete, kiegészítve a SZME-G 2020.04.17. Szakági Műszaki Előírással.

Recently Updated Websites

Xprecide.com (1 second ago.)6666eu.com (3 seconds ago.)Sexualabusevictims.org (4 seconds ago.)Njcreativedirection.com (4 seconds ago.)Textilesmoni-k.com (5 seconds ago.)Mindgarden.studio (5 seconds ago.)Whitetailroyalty.com (6 seconds ago.)Farewell.inc (6 seconds ago.)Steccheares.com (6 seconds ago.)Puntotax.com (8 seconds ago.)Pillbot.app (8 seconds ago.)Thesis.in (8 seconds ago.)Posuiji168.com (8 seconds ago.)Allcashprints.com (9 seconds ago.)Adhocaf.es (9 seconds ago.)10listingsamonth.com (9 seconds ago.)Visitmuskogee.com (10 seconds ago.)Ibuyermanhattan.com (11 seconds ago.)Jxhb9.app (11 seconds ago.)Mx-34.com (11 seconds ago.)Taijasblingboutique.com (11 seconds ago.)Americasbathingsolutions.com (11 seconds ago.)Powereeegroup.com (11 seconds ago.)Thesalazarsistas.com (12 seconds ago.)Ejoyul.com (13 seconds ago.)Leadinsci.info (13 seconds ago.)Nucarrentals.com (13 seconds ago.)Domaieuro.com (14 seconds ago.)Wellenheld.shop (14 seconds ago.)Bookpublishingmagic.com (14 seconds ago.)

Recently Searched Keywords

ks115 (4 seconds ago.)restaurant aruba (6 seconds ago.)imglogo divlogoreplaceimglogo thisfindimglogotext (8 seconds ago.)aeroval (10 seconds ago.)sexe en direct (19 seconds ago.)preparing for future (25 seconds ago.)t396artboardheight 130pxbackground-color (29 seconds ago.)dejiko (30 seconds ago.)《haydee 2》 中文免安装版 (31 seconds ago.)dunia dpn (33 seconds ago.)_sci-fi (34 seconds ago.)documentbodyclientwidth if (34 seconds ago.)marjay type c micro usb 2.4a fast data charging cable for samsung huawei xiaomi for xiaomi note 10 (35 seconds ago.)sun oct (36 seconds ago.)entertainment7 days ago end sars: you are a failure – wizkid tells buhari, osinbajo, igp to resign (38 seconds ago.)especificar (39 seconds ago.)hc kim (41 seconds ago.)dane andersen, dds (44 seconds ago.)roadniagara falls ny (49 seconds ago.)promag 300 (51 seconds ago.)maximum strength (55 seconds ago.)원신 이거 언제 다 먹나 (56 seconds ago.)inmejorable (1 minute ago.)デファクトスタンダード (1 minute 3 seconds ago.)community impact (1 minute 10 seconds ago.)trendoch v portovom (1 minute 13 seconds ago.)эрнст барлах (1 minute 13 seconds ago.)low level jikalau (1 minute 15 seconds ago.)petrpolis rj 24 (1 minute 15 seconds ago.)internet phone (1 minute 17 seconds ago.)