Godaddy.com  |  Domain Names | The World's Largest Domain Name Registrar - GoDaddy UK
High trust score  | 
GoDaddy makes registering Domain Names fast, simple, and affordable. Find out why so many business owners chose GoDaddy to be their Domain Name Registrar.




Godaddy.com Website Information

Website Ranks & Scores for Godaddy.com

Statvoo Rank Statvoo Rank:A+
Alexa Rank Alexa Rank:139
Majestic Rank Majestic Rank:33
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Godaddy.com

Domain Registrar: GODADDY.COM, LLC
Registration Date:1999-03-02  1 decade 9 years 9 months ago
Last Modified:2014-04-09  4 years 7 months 3 weeks ago
Expiration Date:2021-11-01  2 years 10 months 2 weeks from now

Whois information for godaddy.com

Full Whois Lookup for Godaddy.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Godaddy.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: GODADDY.COM
Registry Domain ID: 4013247_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2014-04-09T04:15:36Z
Creation Date: 1999-03-02T05:00:00Z
Registry Expiry Date: 2021-11-01T11:59:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited https://icann.org/epp#serverUpdateProhibited
Name Server: A1-245.AKAM.NET
Name Server: A11-64.AKAM.NET
Name Server: A20-65.AKAM.NET
Name Server: A6-66.AKAM.NET
Name Server: A8-67.AKAM.NET
Name Server: A9-67.AKAM.NET
Name Server: CNS1.GODADDY.COM
Name Server: CNS2.GODADDY.COM
Name Server: CNS3.GODADDY.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-19T10:45:59Z

Who hosts Godaddy.com?

Godaddy.com is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Godaddy.com has an IP Address of 208.109.4.218 and a hostname of ip-208-109-4-218.ip.secureserver.net.



Godaddy.com Web Server Information

Hosted IP Address:208.109.4.218
Hosted Hostname:ip-208-109-4-218.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6119
Location Longitude:-111.8906
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. 208.109.4.218)

Domain Names | The World's Largest Domain Name Registrar - GoDaddy uk
- moveyourweb.net

GoDaddy makes registering Domain Names fast, simple, and affordable. Find out why so many business owners chose GoDaddy to be their Domain Name Registrar.

  Not Applicable   $ 8.95

Domain Names | The World's Largest Domain Name Registrar - GoDaddy UK
- sweetdealsbysm.com

GoDaddy makes registering Domain Names fast, simple, and affordable. Find out why so many business owners chose GoDaddy to be their Domain Name Registrar.

  Not Applicable   $ 8.95

Domain Names | The World's Largest Domain Name Registrar - GoDaddy
- affiliate.godaddy.com

GoDaddy makes registering Domain Names fast, simple, and affordable. Find out why so many business owners chose GoDaddy to be their Domain Name Registrar.

  189   $ 63,540,720.00

Domain Names | The World's Largest Domain Name Registrar - GoDaddy uk
- godaddy.net

GoDaddy makes registering Domain Names fast, simple, and affordable. Find out why so many business owners chose GoDaddy to be their Domain Name Registrar.

  223,222   $ 30,780.00

HTTP Header Analysis for Godaddy.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
P3P: policyref="/w3c/p3p.xml", CP="COM CNT DEM FIN GOV INT NAV ONL PHY PRE PUR STA UNI IDC CAO OTI DSP COR CUR OUR IND"
Content-Length: 43300
Date: Fri, 22 May 2015 14:57:42 GMT
Connection: keep-alive


Need to find out who hosts Godaddy.com?

Godaddy.com Free SEO Report

Website Inpage Analysis for Godaddy.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Godaddy.com

documentcreateelementscripttaken seriously easynewvalueyourusegood events quotthe0low as 299mocustomersmarketinggodaddy website builder365 email marketingsigningtaken seriouslygodaddy websiteowner httpswwwjollygoodeventscouk buildeventswatch nowmarketing customer storygoliketoolget startedbuild yourwindowuxadditional yearsevents quotthe1 web hoststarted299mo get startedchangeshavingstrugglerecipedesignsupportpricingstart for freesiteeasy to usewhileseejenningsworlds mostyoudgodaddycomofferbestrequiredrightspurchase required additionalwithoutoldonloadrequired additional yearswebsite is keydifficult7customer story jollystoryaddressproductsprivatejolly good eventswithout onevarfunctionsuccessofficetermswebsite builder officedatayour com 2yearyr find yourbusiness is difficultpay any additionalinsertscriptsrckeyprivacywebsitegetuxdataimproveagreeaccountlow as 0991sthaveadvertisingrebecca jenningshaving to paywebsite withoutcan make changesget onlineyummy websiteenglishunitedgodaddycustomer story6find yourpurchasequotthe websitebuilder officespecialanygrowsyour recipeyour businessknoweffective the godaddyuser experienceseriouslyblog1 webusing this siteweb hostour newservicecredit cardservice providershour our newevents quotthe websiteinsertscriptsrc callbackyummycallbackbelowhosting trust youryears 1310yrsales supportbuilder is yourthemrightlookingreally goodgrows i candedicated2yearpoint of viewmostbusiness even ifdetailsyour customers0991st yr findhost as low1most popular domainenglishindiavar ellearn more nojennings owner httpswwwjollygoodeventscouknameinitialhour ourdesign pointfunction insertscriptsrcorgcant2year purchasehttpswwwjollygoodeventscouk build yourvisitorswindowonloadfree learneven ifphonenew website buildercard requiredproductadditional moneyquot rebecca23purchase requiredsomeno credit cardwindowcmsadditional moneyquoturlargsbuildingemail365 emailyour sitekeepneedupcollect informationnotampdomainsprofessional4no creditgooddomain nameyoud strugglesite youwithout havingour websitedo5effectivehouryou needwebsite in underyou agreebuilderwebjolly goodexperienceifinformationkey to buildingjennings owneradditional years 1310start0991st yrbuilding a brandmore noany additional moneyquotcanstarted getteamunder an hourweinitial purchase termoffice 365 emailmake changesif youisccookiebuilder was reallydifficult withoutwindowaddeventlistenerloadowner httpswwwjollygoodeventscoukone and youdordercallyounomarketing customerour new websitebuild a yummymarketing a businessworlds 1our privacyouryoureprovidersreallynumberweb hostingrequired additionalcan makeworlds most popularwebsite builderallbranduses cookiesawardwinningbrand marketingyearsbuilder office 365toolsseriously easyadditionalsignany additionalbusiness evenjollyownerlowuse and costparentbusinessfreedifficult without onelinksupport teamcustomerhostingvalidation sslstory jolly299modomain website builderall rightsnew websiteusedtrust your siteeasyget started getweb hosting trustbuild your sitemoneyquot rebeccasslonlykingdomsettimeoutfunctionnowpremiumcollectelfindnewbuildyr findmywebmaildomain as lowuser299mo getpointhosting trusttrustunderhttpswwwjollygoodeventscoukpayhelpreturncredithelp callonegetfalsestory jolly goodmoneyquotcookieswatchcardmoneyquot rebecca jenningsplaceddomain websitehostcostrebecca jennings ownermoreemail marketing customerindiagivesalesenhanceevengood eventsfntermsuccess startsecurefunclearn morecost effectivequotthe0991steven if youtakenpleasewebsite without havingusespopular domainyour experienceyour websitelearnprotecttrust yourpay anymediaplaninitial purchaseoffice 365free learn morerebeccaelseplease seerecipe for successmore no creditmakevalidationmost popularyoullusingemail marketingviewwindowaddeventlistenerload functionworlds 1 webpurchase termworldsonlinefunction insertscriptsrc callbackhttpswwwjollygoodeventscouk buildcredit card requiredbusiness growspopularheresubjectdomain2year purchase required

Longtail Keyword Density for Godaddy.com

KeywordsOccurences
under an hour4
- - -4
worlds most popular4
website in under4
yr find your4
even if you4
business even if4
one and youd3
difficult without one3
taken seriously easy3
easy to use3
business is difficult3
use and cost3
effective the godaddy3
website is key3
jolly good events3
story jolly good3
customer story jolly3
good events quotthe3
events quotthe website3
building a brand3
key to building3
godaddy website builder3
marketing a business3
grows i can3
owner httpswwwjollygood-eventscouk build3
jennings owner httpswwwjollygood-eventscouk3
rebecca jennings owner3
httpswwwjollygood-eventscouk build your3
build your site3
function insertscriptsrc callback3
using this site3
initial purchase term3
moneyquot rebecca jennings3
additional moneyquot rebecca3
can make changes3
marketing customer story3
point of view3
website without having3
having to pay3
any additional moneyquot3
pay any additional3
builder was really3
builder office 3653
credit card required3
no credit card3
more no credit3
most popular domain3
domain as low3
0991st yr find3
low as 0991st3
learn more no3
free learn more3
our new website3
hour our new3
build a yummy3
new website builder3
builder is your3
start for free3
recipe for success3
your com 2-year3
2-year purchase required3
get started get3
299mo get started3
low as 299mo3
domain website builder3
website builder office3
365 email marketing3
office 365 email3
host as low3
1 web host3
additional years 13103
required additional years3
purchase required additional3
web hosting trust3
hosting trust your3
worlds 1 web3
trust your site3
email marketing customer3
your business10
website builder9
get started9
your site8
collect information8
- -6
365 email6
site you5
if you5
website without5
find your5
office 3654
our website4
learn more4
you agree4
worlds most4
yr find4
most popular4
validation ssl4
your website4
insertscriptsrc callback4
domain name4
business even4
even if4
your experience4
service providers4
please see4
additional moneyquot3
make changes3
any additional3
without having3
pay any3
design point3
seriously easy3
taken seriously3
youd struggle3
cost effective3
godaddy website3
business grows3
moneyquot rebecca3
really good3
can make3
build your3
windowaddeventlistenerload function3
function insertscriptsrc3
without one3
var el3
uses cookies3
our privacy3
user experience3
support team3
help call3
httpswwwjollygood-eventscouk build3
owner httpswwwjollygood-eventscouk3
jennings owner3
sales support3
all rights3
purchase term3
initial purchase3
rebecca jennings3
builder office3
get online3
card required3
credit card3
no credit3
popular domain3
0991st yr3
required additional3
purchase required3
2-year purchase3
more no3
free learn3
yummy website3
you need3
your customers3
hour our3
our new3
success start3
your recipe3
new website3
additional years3
years 13103
story jolly3
customer story3
marketing customer3
email marketing3
jolly good3
good events3
brand marketing3
quotthe website3
events quotthe3
domain website3
watch now3
trust your3
hosting trust3
web hosting3
worlds 13
1 web3
started get3
299mo get3
web host3
difficult without3
077
your67
website37
you36
our29
if28
site26
domain25
function25
var22
business22
information21
use18
get17
web13
ssl12
more11
find11
cookies11
customers11
collect10
can9
purchase9
started9
builder9
experience9
we9
godaddy9
email9
-8
worlds8
account8
return8
without8
all8
term8
urlargs8
order8
need8
else8
low8
amp7
used7
17
help7
build7
callback7
only7
best7
privacy7
additional7
good6
learn6
make6
marketing6
one6
free6
online6
name6
start6
any6
new6
required6
them6
offer6
visitors6
25
please5
func5
35
number5
up5
el5
support5
office5
trust5
like5
have5
right5
products5
under5
tools5
youre5
my5
youll4
view4
service4
44
see4
enhance4
providers4
even4
details4
while4
product4
keep4
windowux4
agree4
terms4
call4
phone4
blog4
do4
hour4
not4
validation4
advertising4
professional4
popular4
yr4
give4
india4
most4
special4
success4
isccookie4
no4
englishindia4
insertscriptsrc4
windowonload4
data4
now4
org4
englishunited4
54
kingdom4
settimeoutfunction3
team3
premium3
sign3
private3
fn3
using3
newvalue3
godaddycom3
link3
63
getuxdata3
windowaddeventlistenerload3
documentcreateelementscript3
uses3
address3
media3
webmail3
cant3
improve3
some3
oldonload3
tool3
false3
user3
parent3
looking3
below3
placed3
windowcms3
sales3
story3
jolly3
customer3
go3
watch3
signing3
events3
brand3
difficult3
building3
key3
quotthe3
know3
299mo3
here3
credit3
dedicated3
yummy3
recipe3
card3
0991st3
hosting3
host3
73
years3
2-year3
youd3
struggle3
httpswwwjollygood-eventscouk3
award-winning3
owner3
jennings3
rebecca3
secure3
domains3
initial3
pricing3
protect3
plan3
rights3
moneyquot3
pay3
cost3
effective3
easy3
seriously3
taken3
really3
design3
having3
changes3
grows3
point3
subject3

What are the nameservers for godaddy.com?

Godaddy.com Domain Nameserver Information

HostIP AddressCountry
a11-64.akam.net 84.53.139.64United States United States
a9-67.akam.net 184.85.248.67United States United States
cns1.godaddy.com 208.109.255.100United States United States
cns2.godaddy.com 216.69.185.100United States United States
cns3.godaddy.com 72.167.7.102United States United States

Godaddy.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
godaddy.comA555IP: 97.74.104.218
godaddy.comNS2711Target: a6-66.akam.net
godaddy.comNS2711Target: a20-65.akam.net
godaddy.comNS2711Target: cns3.godaddy.com
godaddy.comNS2711Target: a11-64.akam.net
godaddy.comNS2711Target: a9-67.akam.net
godaddy.comNS2711Target: a1-245.akam.net
godaddy.comNS2711Target: a8-67.akam.net
godaddy.comNS2711Target: cns1.godaddy.com
godaddy.comNS2711Target: cns2.godaddy.com
godaddy.comSOA3600MNAME: cns1.godaddy.com
RNAME: dns.jomax.net
Serial: 2015051900
Refresh: 300
Retry: 600
Expire: 1209600
godaddy.comMX2706Target: godaddy-com.mail.protection.outlook.com
godaddy.comTXT60TXT: MS=ms83569812
godaddy.comTXT60TXT: v=spf1 ip4:207.200.21.144/28
ip4:12.151.77.31 ip4:69.64.33.132
ip4:68.233.77.16 ip4:184.168.131.0/24
ip4:173.201.192.0/24 ip4:182.50.132.0/24
ip4:170.146.0.0/16 ip4:174.128.1.0/24
ip4:173.201.193.0/24
include:spf-2.domaincontrol.com -all
godaddy.comTXT60TXT: IPROTA_D17829-XXX.TXT

Alexa Traffic Rank for Godaddy.com


Alexa Search Engine Traffic for Godaddy.com