Velkommen til Grønt Fokus

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9

Grønt Fokus er Norges største og ledende leverandør av drivhus, veksthus, hagestue og vinterhage. I tillegg selger vi skyvedørsgarderober, ytterdører, terrassed



Domain summary

Last updated
2020-11-07
Domain label
grontfokus
Domain extension
no
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Grontfokus.no registered?
A: Grontfokus.no was registered 8 months, 3 weeks, 4 days, 9 hours, 12 minutes, 34 seconds ago on Saturday, November 7, 2020.
Q: When was the WHOIS for Grontfokus.no last updated?
A: The WHOIS entry was last updated 8 months, 3 weeks, 4 days, 9 hours, 12 minutes, 34 seconds ago on Saturday, November 7, 2020.
Q: What are Grontfokus.no's nameservers?
A: DNS for Grontfokus.no is provided by the following nameservers:
  • ns1.inbranddns.com
  • ns2.inbranddns.com
  • ns4.inbranddns.com
  • ns3.inbranddns.com
Q: Who is the registrar for the Grontfokus.no domain?
A: The domain has been registered at .
Q: What is the traffic rank for Grontfokus.no?
A: Grontfokus.no has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Grontfokus.no each day?
A: Grontfokus.no receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Grontfokus.no resolve to?
A: Grontfokus.no resolves to the IPv4 address 193.12.177.233.
Q: In what country are Grontfokus.no servers located in?
A: Grontfokus.no has servers located in the Sweden.
Q: What webserver software does Grontfokus.no use?
A: Grontfokus.no is powered by Microsoft-IIS/7.5 webserver.
Q: Who hosts Grontfokus.no?
A: Grontfokus.no is hosted by TELE2 in Skåne, Lund, Sweden, 220 02.
Q: How much is Grontfokus.no worth?
A: Grontfokus.no has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Grontfokus.no Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Grontfokus.no Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Grontfokus.no

H1 Headings

1 :
  1. 40% på reisverket– ferdigkappet og grunnbehandlet

H2 Headings

2 :
  1. fargen på kjøpet
  2. 20% rabatt på alle vinduer

H3 Headings

8 :
  1. Hagestuer
  2. Dører
  3. Vinduer
  4. Grønt Fokus
  5. Følg oss
  6. Inspirasjon
  7. Nyhetsbrev
  8. Få hjelp av våre rådgivere!

H4 Headings

2 :
  1. Kampanjen gjelder t.o.m. 9. november.
  2. Kampanjen gjelder t.o.m. 9. november

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-4552725-1

Links - Internal

116:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Grontfokus.no

daysavdelingeraringogiftilhjelpoversiktif dataiitemtypecurrentscrolllevegg ogom vreheightallesedataiitemtypedatafunctionsuccess functionsttteomtopcartbuttonwidthdatailabeldelim s4 delimossboderrepavdelinger oversiktse allecodetitle false functionkontaktinlinechannelidkomplett hagestuerinspirasjontitle falsechangetransitionvalueexpireselsegr248nt fokuss4komplettsolskjermingogssvarurlreturn truetextmixresultsappendchildlink0true titlese ogsleveggfduproff290 maxwidths4 delimlenanneksf hjelp avvinduereog pergolahrefstringsp248rsm229l0 lenhtmlajaxog boders4 delim s4return falseif currentscrolllastscrollv229refalse functionlevegg og pergolaf hjelpog hagestueclearchildrenresultsd248rersttte inspirasjon omtrue title falsevaringregr248ntreturnavdrivhuscookiespergolainputtitlesttte inspirasjoncountviav en proffuidkeykeyupvinterhageepreventdefaultlen i ifcustomizedmessagehagestuerdelim s4resultsv229re butikkertrueloop54buttonvinterhage og hagestueanneks ogfalses4 s4hagestuegarderobersuccessfunction htmlshowpasswordbtninspirasjon omhjelp avvaranneks og boder1000pxajax url3inspirasjon om vreloginformbutikkermaxwidthlinksetattributeclasspasswordinline truedelimfokussearchqvreerrorinputvalutemilj2481paringkontakt ossfunction datainline true titlevinterhage og

Longtail Keyword Density for Grontfokus.no

KeywordsOccurences
sttte inspirasjon om10
inspirasjon om vre10
anneks og boder7
levegg og pergola6
f hjelp av4
av en proff4
s4 delim s44
inline true title4
true title false4
vinterhage og hagestue3
delim s4 delim3
title false function3
len i if3
se ogs12
sttte inspirasjon10
inspirasjon om10
om vre10
avdelinger oversikt7
anneks og7
og boder7
inline true6
title false6
levegg og6
og pergola6
hjelp av5
s4 delim4
ajax url4
success function4
delim s44
komplett hagestuer4
return true4
true title4
f hjelp4
if currentscroll3
90 maxwidth3
false function3
return false3
0 len3
kontakt oss3
gr248nt fokus3
function html3
function data3
s4 s43
v229re butikker3
se alle3
og hagestue3
vinterhage og3
if dataiitemtype3
function46
var44
og34
if32
se17
return16
inspirasjon15
true14
014
avdelinger14
false13
ogs12
om12
drivhus11
vre10
sttte10
alle9
s49
else9
hagestuer8
av7
garderober7
boder7
anneks7
width7
oversikt7
loop54-button7
results7
input7
customizedmessage6
inline6
title6
len6
cookies6
16
vi6
du6
levegg6
oss6
pergola6
hjelp5
e5
currentscroll5
butikker5
til5
html5
data5
f5
hagestue5
delim5
vinduer5
aring5
proff4
datailabel4
hrefstring4
epreventdefault4
inputval4
paring4
code4
text4
rep4
fokus4
loginform4
24
searchq4
url4
ajax4
komplett4
success4
mix4
uid4
key4
count4
expires4
password3
dataiitemtype3
svar3
kontakt3
error3
showpasswordbtn3
clearchildrenresults3
change3
keyup3
resultsappendchildlink3
linksetattributeclass3
d248rer3
v229re3
days3
gr248nt3
varingre3
33
solskjerming3
sp248rsm229l3
value3
topcartbutton3
lastscroll3
utemilj2483
vinterhage3
maxwidth3
1000px3
height3
transition3
channelid3

Who hosts Grontfokus.no?

Grontfokus.no Hosting Provider Information

Hosted IP Address:193.12.177.233
Hosted Hostname:dimachosting.net
Service Provider:TELE2
Hosted Country:SwedenSE
Location Latitude:55.7028
Location Longitude:13.1927
Webserver Software:Microsoft-IIS/7.5

Is "TELE2" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%
TELE2
0.0088%

HTTP Header Analysis for Grontfokus.no

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Access-Control-Allow-Origin: *
Date: Sat, 07 Nov 2020 13:04:56 GMT
Content-Length: 12719

Grontfokus.no Domain Nameserver Information

HostIP AddressCountry
ns1.inbranddns.com 62.116.159.4
ns2.inbranddns.com 217.160.113.37
ns4.inbranddns.com 74.208.254.4
ns3.inbranddns.com 89.146.248.4


Need to find out who hosts Grontfokus.no?


Domain Registration (WhoIs) information for Grontfokus.no

 % By looking up information in the domain registration directory
% service, you confirm that you accept the terms and conditions of the
% service:
% https://www.norid.no/en/domeneoppslag/vilkar/
%
% Norid AS holds the copyright to the lookup service, content,
% layout and the underlying collections of information used in the
% service (cf. the Act on Intellectual Property of May 2, 1961, No.
% 2). Any commercial % use of information from the service, including
% targeted marketing, is prohibited. Using information from the domain
% registration directory service in % violation of the terms and
% conditions may result in legal prosecution.
%
% The whois service at port 43 is intended to contribute to resolving
% technical problems where individual domains threaten the
% functionality, security and stability of other domains or the
% internet as an infrastructure. It does not give any information
% about who the holder of a domain is. To find information about a
% domain holder, please visit our website:
% https://www.norid.no/en/domeneoppslag/

Domain Information

NORID Handle...............: GRO1260D-NORID
Domain Name................: grontfokus.no
Registrar Handle...........: REG646-NORID
Tech-c Handle..............: JP40R-NORID
Name Server Handle.........: NSIN791H-NORID
Name Server Handle.........: NSIN792H-NORID
Name Server Handle.........: NSIN793H-NORID
Name Server Handle.........: NSIN794H-NORID

Additional information:
Created: 1999-11-15
Last updated: 2020-03-27

Websites with Similar Names

Gront-hav.com
Forside | Berner Tor Willy - Grønt Hav
Gront-hus.com
gront-hus.com — Coming Soon
Gront-kaffe-se.xyz
Snabb och effektiv viktminskning piller - Det fungerar bra.
Gront-nok.com
gront-nok.com is parked
Gront-rad.com
Forside | Norseth Pen Andreas - Grønt Råd AS
Gront-renhold.com
Grønt Renhold - Vennlige rengjøring tjenester - Oslo, Bærum, Asker
Grontanlegg.com
Domenenavnet er parkert hos FastName
Grontapu.world
GronTapu | Creativity in vision, sound and more… | #polyStylism
Grontarrangement.com
grontarrangement.com is parked
Grontbolan.com
Parked at Loopia

Recently Updated Websites

Digitalheadstones.biz (5 seconds ago.)Alkhalidiyaholidays.com (6 seconds ago.)Urbinoinrete.it (8 seconds ago.)Zeroeightysevenproductions.com (10 seconds ago.)Jimcaruk.com (11 seconds ago.)Unisonweb.org (13 seconds ago.)Modernfarmkitchen.guru (17 seconds ago.)Ivyeducation.cn (23 seconds ago.)Khrysalis.net (26 seconds ago.)Twrifle.com (27 seconds ago.)A-trompa.net (28 seconds ago.)Tradesecretsforbaby.com (33 seconds ago.)Victoryovervirus.com (34 seconds ago.)Payerwizard.com (34 seconds ago.)Primrosehiddenlakes.com (34 seconds ago.)Imaginationbuilder.com (37 seconds ago.)Imperatori.biz (38 seconds ago.)Denhamedia.com (38 seconds ago.)Monti.business (40 seconds ago.)Veltassa-global.com (42 seconds ago.)Augmentspace.com (50 seconds ago.)Tffeuerbach.de (51 seconds ago.)Palazzocarrano.com (51 seconds ago.)Surv-shop.com (51 seconds ago.)Royalgold.com (51 seconds ago.)Blueboottech.com (54 seconds ago.)Bookkeepersnyc.com (57 seconds ago.)Maximusmedical.com (57 seconds ago.)94feetperformance.org (58 seconds ago.)Cumgum.org (1 minute 1 second ago.)

Recently Searched Keywords

irlanda itlia frana (1 second ago.)статья о.в. дегтевой “строительная история спасо-преображенской церкви в селе вершилово нижегородской области” (1 second ago.)恋童导航 (2 seconds ago.)paralysis sleep (3 seconds ago.)mount view primary school ranking (4 seconds ago.)grandeur (5 seconds ago.)nemli kurallarndan (5 seconds ago.)bless hair style (6 seconds ago.)herman part 2 (7 seconds ago.)橋本環奈 (8 seconds ago.)厂家供应批发厦门优质地毯 (8 seconds ago.)dim sağlamlıq haqqında bəyannamə (9 seconds ago.)3 comments  (10 seconds ago.)national research foundation of south africa (10 seconds ago.)ddpzq (10 seconds ago.)style-jxa9iveymenucontainerarrowstyle-jxa9iveymenucontainercenter-direction (14 seconds ago.)தமிழகத்தில் ஒரே நாளில் 8 பேர் உயிரிழப்பு : பலி எண்ணிக்கை 61 ஆக உயர்வு (15 seconds ago.)lithium ion battery manufacturing equipment suppliers (15 seconds ago.)plantsome rabattcode (15 seconds ago.)as-su su teknolojileri (16 seconds ago.)18ef8f655f1604419425f17b114 (17 seconds ago.)pegagan tanaman obat (19 seconds ago.)dc:contributor (20 seconds ago.)m�thodes, pratiques et innovations (20 seconds ago.)greyscalegorilla - introduction to houdini (20 seconds ago.)richiesta di riabilitazione penale modello (21 seconds ago.)merch line (22 seconds ago.)coffee traders kalispell (22 seconds ago.)от 2 215 руб. (22 seconds ago.)urlhttpstiimgtistaticcomcatalogstemplate79136enquirybgjpg top (24 seconds ago.)