|  Groupon : des bons plans sur les restaurants, les salles de sport, les voyages, le shopping, la beauté et bien plus.
Low trust score  | 
Des deals offrant de 50 à 90% de réduction sur les restaurants, salles de sport, voyages, le shopping, la beauté, les spas, les cadeaux et bien plus encore. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:5,796
Majestic Rank Majestic Rank:111,227
Domain Authority Domain Authority:56%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

%% This is the AFNIC Whois server.
%% complete date format : DD/MM/YYYY
%% short date format : DD/MM
%% version : FRNIC-2.5
%% Rights restricted by copyright.
%% See
%% Use '-h' option to obtain more information about this service.
%% [2a01:7e00:0000:0000:f03c:91ff:fe84:f734 REQUEST] >>
%% RL Net [##########] - RL IP [#########.]

status: ACTIVE
hold: NO
holder-c: GI806-FRNIC
admin-c: DR1218-FRNIC
tech-c: SA5280-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL140238-FRNIC
Expiry Date: 29/11/2017
created: 14/10/2009
last-update: 25/11/2016
source: FRNIC

ns-list: NSL140238-FRNIC
source: FRNIC

type: Isp Option 1
address: 2711 Centerville Road, Suite 400
address: DE 19808 WILMINGTON
country: US
phone: +1 302 636 5401
fax-no: +1 302 636 5454
e-mail: Login to show email
anonymous: NO
registered: 17/10/2006
source: FRNIC

nic-hdl: GI806-FRNIC
contact: Groupon, Inc.
address: Groupon, Inc.
address: 600 W. Chicago Ave
address: Suite 620
address: 60654 Chicago IL
country: US
phone: +1 3128705288
fax-no: +1 3122757757
e-mail: Login to show email
changed: 29/11/2010 Login to show email
obsoleted: NO
eligstatus: ok
eligdate: 30/11/2010 10:57:25
source: FRNIC

nic-hdl: DR1218-FRNIC
type: PERSON
contact: Domain Registrar
address: Corporation Service Company France
address: 68, rue du faubourg Saint Honore
address: 75008 Paris
country: FR
phone: +33 1 53 43 64 92
fax-no: +33 1 53 43 63 00
e-mail: Login to show email
changed: 11/11/2009 Login to show email
obsoleted: NO
eligstatus: ok
eligsource: REGISTRAR
eligdate: 03/12/2014 15:43:26
reachmedia: email
reachstatus: ok
reachsource: REGISTRAR
reachdate: 06/12/2011 22:29:37
source: FRNIC

nic-hdl: SA5280-FRNIC
type: PERSON
contact: Systems Administrator
address: Groupon, Inc.
address: 600 W. Chicago Ave Suite 620
address: 60654 Chicago IL
country: US
phone: +1 3128705288
fax-no: +1 3122757757
e-mail: Login to show email
changed: 11/11/2010 Login to show email
obsoleted: NO
source: FRNIC

Who hosts is hosted by GI Switzerland GmbH in Schaffhausen, Schaffhausen, Switzerland, 8200. has an IP Address of and a hostname of and runs nginx/1.6.2 web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:GI Switzerland GmbH
Hosted Country:SwitzerlandCH
Location Latitude:47.6973
Location Longitude:8.63493
Webserver Software:nginx/1.6.2

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.6.2
Content-Type: text/html; charset=utf-8
X-Powered-By: Express
Cache-Control: private, max-age=0, no-cache, no-store, must-revalidate
X-Request-Id: aa891632-f5f8-40f3-8a4a-4b569068a448
X-B-Cookie: 71eb5c08-a8fd-4353-a3ef-9ab253ffb16a
X-S-Cookie: ce2e958f-ef17-4b58-bee2-73a2068b09a0
X-P0-Cookie: 1
X-UA-Compatible: IE=edge,chrome=1
X-Frame-Options: DENY
X-Destination: homepage_ita
Content-Encoding: gzip
Content-Length: 23525
Vary: Accept-Encoding
Date: Tue, 09 Jun 2015 10:54:32 GMT
Connection: keep-alive

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

code promoundefinedpour iphonemerciacheteurs00 subdlgreturndivemail59 jusquspafontweight 300fontsizebackgroundpositionxlille13marginfontweightfontsize 10pxbientrelesquinsubscribemodalcontainer3codepourkm 40 acheteurssubdlg divmessageh1summerampacheteurs 280 dsborderiphonesubdlglcd pour17les dealsfrancelcd pour iphonevoyagesparsports12shoppingdeskm 10008jusqu 42 surccookiedivmessagecolor 000leposition absolute2pxpadding 4pxadressespadding 10pxlineheightjusqu 42varpermisdivfineprintwidthflagsausubdlg dlgfooter5vousmodefunctionrestaurantsmargin 20px42 surmobileplusieurs adressesecookiefr20px subdlgservices30pxautoleskmaux10px19achatheightrightpromo10p fontsize1597h2cominesp marginsubdlg h14position280 dspluscentermaison20px20tous les1au choixsubdlg h4votreprivatifmaison ampjusquabsoluteds 29fontsize 20pxsortiessurmargin 10pxbest4px1h30politiquesubdlg divmessage ploisirsmargintop8pxtouscolor000 subdlgdealsh4best of summerwidth 100acheteurs dsmargin auto53a318etun2ou100pxspa privatif0 widthformationif16borderradiusdisplaydisplay nonenonesubdlg divfineprintsitesur desplusieurstous les deals618crelativetopgrouponfontweight 700divmessage pposition relativekm 40rparationdsacheteurs 28010px subdlgdivmessage p fontsizecookieslcdchoix1140 acheteurssubdlg h2aveccolor 000 subdlgsubdlg divemailsantbackgroundnullmargin 0dtentepgoogletagmanagerkm 1000 acheteursstringpaddingdlgfooter000beaut1000 acheteursleft14left 0

Longtail Keyword Density for

km 1000 acheteurs5
jusqu -42 sur4
divmessage p font-size3
color 000 subdlg3
subdlg divmessage p3
acheteurs 280 ds3
km 40 acheteurs3
tous les deals3
lcd pour iphone3
best of summer3
code promo58
1000 acheteurs7
subdlg divmessage7
0 subdlg6
spa privatif5
km 10005
tous les5
p font-size4
les deals4
position absolute4
-42 sur4
acheteurs ds4
margin 04
display none4
jusqu -424
divmessage p4
subdlg dlgfooter4
width 1004
plusieurs adresses4
color 0003
000 subdlg3
margin 10px3
10px subdlg3
font-size 20px3
font-size 10px3
padding 4px3
subdlg divfine-print3
20px subdlg3
margin 20px3
p margin3
subdlg h23
subdlg divemail3
subdlg h43
position relative3
ds 293
km 403
40 acheteurs3
au choix3
pour iphone3
maison amp3
sur des3
lcd pour3
59 jusqu3
acheteurs 2803
left 03
0 width3
padding 10px3
font-weight 7003
font-weight 3003
280 ds3
margin auto3
subdlg h13

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?