Grupopmg.com.ar Favicon Grupopmg.com.ar

Grupopmg.com.ar Website Thumbnail
Checking...
Home | PMG Group
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
grupopmg
Domain extension
com.ar
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is grupopmg.com.ar ranked relative to other sites:

Percentage of visits to grupopmg.com.ar from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Grupopmg.com.ar registered?
A: Grupopmg.com.ar was registered 1 month, 2 weeks, 13 hours, 38 minutes, 31 seconds ago on Thursday, September 17, 2020.
Q: When was the WHOIS for Grupopmg.com.ar last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 13 hours, 38 minutes, 31 seconds ago on Thursday, September 17, 2020.
Q: Who is the registrar for the Grupopmg.com.ar domain?
A: The domain has been registered at .
Q: What is the traffic rank for Grupopmg.com.ar?
A: Grupopmg.com.ar has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Grupopmg.com.ar each day?
A: Grupopmg.com.ar receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Grupopmg.com.ar resolve to?
A: Grupopmg.com.ar resolves to the IPv4 address 23.236.62.147.
Q: In what country are Grupopmg.com.ar servers located in?
A: Grupopmg.com.ar has servers located in the United States.
Q: What webserver software does Grupopmg.com.ar use?
A: Grupopmg.com.ar is powered by webserver.
Q: Who hosts Grupopmg.com.ar?
A: Grupopmg.com.ar is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Grupopmg.com.ar worth?
A: Grupopmg.com.ar has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Grupopmg.com.ar?

Grupopmg.com.ar Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Grupopmg.com.ar

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 17 Sep 2020 21:46:36 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.grupopmg.com.ar/
content-language: en
X-Wix-Request-Id: 1600379196.75139270228847981203
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: jeslxIFvDH4ulYwNNi 3Muwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkViozyX1iilefXjG31S4IO7n,2d58ifebGbosy5xc FRalr2o/PtDueXObBVgnuzMlm7tHKLnucQl rChy9uneHz6crT8gY5 4h88PquAG2zWXg==,2UNV7KOq4oGjA5 PKsX47COQw3BjVFoMBu6hWXG/pBM=,m0j2EEknGIVUW/liY8BLLrlXYUr9r2h7s/nblQTovQE=,1wy2ILu/S4rlWT/R4rqCrTx0ZI44gL5XVBYapLxY6tc=,gZE4V9HjxqLIHwGwkmiVcOUiPbGlLtfCwXndRC AQvEaWyug/ZdHQ36uOAkr89T0,nxVDKlf5lZ8xGkFSmm2J1s6EnLicctRWDKAynUgXCPXUa uW81yoLK40KwiEqva5
Cache-Control: no-cache
Expires: -1

Grupopmg.com.ar Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Grupopmg.com.ar?


Domain Registration (WhoIs) information for Grupopmg.com.ar

Grupopmg.com.ar Free SEO Report

Website Inpage Analysis for Grupopmg.com.ar

H1 Headings

0 :

H2 Headings

22 :
  1. ASÍ SOMOS.
  2. ASÍ PENSAMOS.
  3. Somos PMG.
  4. Una agencia eternamente enamorada de las marcas.
  5. Somos el redescubrir de la pasión por comunicar.
  6. Somos nuestros clientes.
  7. Somos #BrandLovers
  8. Qué hacemos:
  9. Nuestros trabajos:
  10. Clientes:
  11. Contacto:
  12. PMG Brasil
  13. [email protected]
  14. PMG Chile
  15. [email protected]
  16. PMG Perú
  17. [email protected]
  18. PMG Argentina
  19. Juan Díaz de Solís 2348,
  20. Olivos, Buenos Aires.
  21. (54.11) 5198.9220
  22. [email protected]

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

17 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

5:
  1. https://www.grupopmg.com.ar
    https://www.grupopmg.com.ar
  2. Grupopmg Qué Hacemos
    https://www.grupopmg.com.ar
  3. Grupopmg Trabajos
    https://www.grupopmg.com.ar
  4. Grupopmg Clientes
    https://www.grupopmg.com.ar
  5. Grupopmg Contacto
    https://www.grupopmg.com.ar

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. https://www.facebook.com/Pmggrupo
    https://www.facebook.com/Pmggrupo
  2. https://www.instagram.com/grupopmg/
    https://www.instagram.com/grupopmg/
  3. https://www.linkedin.com/company/grupo-pmg/
    https://www.linkedin.com/company/grupo-pmg/
  4. https://vimeo.com/user116431138
    https://vimeo.com/user116431138

Links - Outbound (nofollow)

0:

Keyword Cloud for Grupopmg.com.ar

haz clicpagofacil western unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaadinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0 0font normalstrc1dataresponsivebuttoncompk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 000000colorrgb0 015px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compk4sduaectrabajo 1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667dd8ed47ac817a438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667dd8ed47ac817a438fc58bc077idx13ingroupidx1dtoid1503667dd8ed47ac817a438fc58bc077width800height500itemid1503667dd8ed47ac817a438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewesternolganartitlestanley blacknormal normal 50px14emfontfamilyselectdataerrortruegalleryitemtitlecompk4sduaec progalleryinlinestyles galleryitemcontainer255compk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesspottitlemercedesbenzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulasummerspot2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1eecb45ba85d77d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1eecb45ba85d77d4052a6a64cidx4ingroupidx1dtoidc599c0d1eecb45ba85d77d4052a6a64cwidth1280height720itemidc599c0d1eecb45ba85d77d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientasbuttoncompk4sduaec progalleryinlinestylesselectdatapreviewhover13pxfullscreennavoldirrtl0swfontcb1de21281807f72cd42ed861fc99dfbcd9e8fwf1281807f72cd42ed861fc99dforiggothamroundedbookstrokewidthdinnextw01lightdinnextw02lightdinnextw10lightsansserifgalleryitemcontainer galleryitemwrappernormal boldifwiximagepositionfixedlinktargetblanktypewixdatapageidtyabftargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800focalpoint02706250369filenameportadareelagenciajpgnamecb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgmediaurlcb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left0width374height235offsettop0left0right370bottom231groupoffsettop0left0right37429693251533735bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left0right374bottom235visibletruerenderedtruerequiredtrueidg1cb9e63992fce44129fd153f46eb2d7d1idx1stripidx1instripidx2islastgroupfalseitemsidcb9e63992fce44129fd153f46eb2d7d1idx1ingroupidx1dtoidcb9e63992fce44129fd153f46eb2d7d1width800height500itemidcb9e63992fce44129fd153f46eb2d7d1securefalseorderindex15928626346380024metadatadescriptioneventostitlereellinktargetblanktypewixdatapageidtyabetargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenameportadaeventosjpgnamecb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgmediaurlcb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left374width374height235offsettop0left374right744bottom231groupoffsettop0left374right7482969325153374bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left374right748bottom235visibletruerenderedtruerequiredtrueidg2169fb0f365bd4335b2179c3ffcae680aidx2stripidx1instripidx3islastgrouptrueitemsid169fb0f365bd4335b2179c3ffcae680aidx2ingroupidx1dtoid169fb0f365bd4335b2179c3ffcae680awidth500height500itemid169fb0f365bd4335b2179c3ffcae680asecurefalseorderindex1592863432266metadatadescriptionestrategia digitaltitleblackborderradius0newborderwidth2pxprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfogalleryitemtopinfoaumentadatitleremanlinktargetblanktypewixdatapageidtyab5targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight501width1015filenamereman05jpgnamecb1de2cab4dae767344d51a36072bb530a98f9mv2jpgmediaurlcb1de2cab4dae767344d51a36072bb530a98f9mv2jpgdirectlinkdirectsharelinknullstylewidth389cubedwidth389height192cubedheight192top0bottomautoleft0rightautowidth389maxwidth1015outerwidth393infowidth0margins2ratio2025948103792415cropratio1iscroppedfalsecroptypefillheight192maxheight501outerheight196infoheight0grouptop41879124238977676left0width393height196offsettop41879124238977676left0right389bottom6107912423897767groupoffsettop41879124238977676left0right3929507543305557bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width393height196infoheight0infowidth0ratio20051020408163267top41879124238977676left0right393bottom6147912423897767visibletruerenderedtruerequiredtrueidg7136d7bd465974145b381651f1ff16473idx7stripidx3instripidx2islastgroupfalseitemsid136d7bd465974145b381651f1ff16473idx7ingroupidx1dtoid136d7bd465974145b381651f1ff16473width500height500itemid136d7bd465974145b381651f1ff16473securefalseorderindex1592863491643metadatadescriptioncontenidos digitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2020202020202020202mesaprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatornormal 22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationbuttoncompk4sduaec progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorcompk4sduaec profullscreenwrapper04scursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincurstylekao3jox4navcontainerarrowb0b0b0creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulafullscreenmobilebartopautobottom0galleryitemdescriptioncompk4sduaec progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorstylekao3jox4navcontainerarrowstylekao3jox4navcontainerleftdirectionffffffcolorrgb36 35n nninfosvgtypeshapeviewbox0 0galleryitemwrapper galleryslideshowinfo svgnormal normal 16px14emgalleryitemcontainerprogallerymobileindicator galleryitemwrapperfffgalleryitemdescriptioncompk4sduaec progalleryinlinestyles galleryitemcontainer6amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename20202jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c33167430fb55b93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c33167430fb55b93d413a7a386idx11ingroupidx1dtoid7eac53c33167430fb55b93d413a7a386width1200height1200itemid7eac53c33167430fb55b93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar 2018titleheropara redes socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesacolorprogalleryinlinestyles galleryitemcontainer galleryitemwrapperinfoelementtitleitemfontslideshow normal normalgalleryitemwrapper galleryslideshowinfogalleryitemcontainerprogallerymobileindicatorultxtnewgalleryitemwrapperpositionstaticboxshadow000 0 0buttonnotprogallerylovednotinfoelementlovedcompk4sduaec progalleryinlinestylesultxtnew olimportantfontnormal normaltutxtnew ulboldoverflowhiddencompk4sduaecrgba00 importantcompk4sduaecfont normal normalcompk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesfontnormal normaldeckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8ac1947f9bf7c3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8ac1947f9bf7c3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8ac1947f9bf7c3fb3a6a125aawidth1015height500itemid90dc5ac8ac1947f9bf7c3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac comoformatttf fontface fontfamilyauto0 importantfontnormal normalprogalleryinlinestyles galleryitemcontainer galleryslideshowinfo980pxunion y pagoy creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667dd8ed47ac817a438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667dd8ed47ac817a438fc58bc077idx13ingroupidx1dtoid1503667dd8ed47ac817a438fc58bc077width800height500itemid1503667dd8ed47ac817a438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewestern235 0 097elctricastitlestanleylinktargetblanktypewixdatapageidtyab7targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2020202020202020202mesainotprogallerylovednotinfoelementlovedcompk4sduaecinfoelementcustombuttonwrapper buttoncompk4sduaecvar1 stylekao3jox4navcontainerfcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacil05infoelementtitleitemfontslideshownormal 15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowpositionstaticboxshadow000235 0 importantcompk4sduaecnormal 16px14emgalleryslideshowinfo infoelementtitleitemfontslideshow normal04s ease 0s255 255compk4sduaec profullscreenwrapper2importantzindex50dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow 000000colorrgb0 0255 255 1somosacompk4sduaecgalleryitemcontainerprogallerymobileindicator galleryitemtopinfourlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto0 importantfontnormal0 0 1spottitlemercedesbenzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulasummerspot2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1eecb45ba85d77d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1eecb45ba85d77d4052a6a64cidx4ingroupidx1dtoidc599c0d1eecb45ba85d77d4052a6a64cwidth1280height720itemidc599c0d1eecb45ba85d77d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientas para ganartitlestanley1backgroundcolorrgba255helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compk4sduaec15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0ganartitlestanleyredes socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesaffffffcolorrgb36inotprogallerylovedcompk4sduaec profullscreenwrappergalleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompk4sduaec progalleryinlinestyles0 0fontnormalfffffffullscreensidebarsocialy pagomarginleft calc100 980px255compk4sduaec profullscreenwrappergalleryitemhover svgbuttoncompk4sduaec profullscreenwrappergalleryitemcontainer04s easeimportantcompk4sduaec progalleryinlinestylesaumentadatitleremanlinktargetblanktypewixdatapageidtyab5targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight501width1015filenamereman05jpgnamecb1de2cab4dae767344d51a36072bb530a98f9mv2jpgmediaurlcb1de2cab4dae767344d51a36072bb530a98f9mv2jpgdirectlinkdirectsharelinknullstylewidth389cubedwidth389height192cubedheight192top0bottomautoleft0rightautowidth389maxwidth1015outerwidth393infowidth0margins2ratio2025948103792415cropratio1iscroppedfalsecroptypefillheight192maxheight501outerheight196infoheight0grouptop41879124238977676left0width393height196offsettop41879124238977676left0right389bottom6107912423897767groupoffsettop41879124238977676left0right3929507543305557bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width393height196infoheight0infowidth0ratio20051020408163267top41879124238977676left0right393bottom6147912423897767visibletruerenderedtruerequiredtrueidg7136d7bd465974145b381651f1ff16473idx7stripidx3instripidx2islastgroupfalseitemsid136d7bd465974145b381651f1ff16473idx7ingroupidx1dtoid136d7bd465974145b381651f1ff16473width500height500itemid136d7bd465974145b381651f1ff16473securefalseorderindex1592863491643metadatadescriptioncontenidos0 0galleryslideshowinfo infoelementtitleitemfontslideshownormal normal 15px18pxprogalleryinlinestyles galleryitemcontainergalleryitemcontainer galleryitemtopinfohelveticaw01lighthelveticaw02lightsansseriftextdecorationgalleryslideshowinfo galleryitemtitlecompk4sduaecprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesol ultxtnew0 200galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfoprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav249 249yournormal normal 22px27pxinfoelementtitlecompk4sduaecborderstylesolidbordercolorrgba249galleryitemwrapper galleryitemhoverwestern unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa ypara redesfill0fontnormalborderwidth2px borderstylesolidbordercolorrgba249249 1backgroundcolorrgba255union y0 097normal normal 15px14emgalleryitemdescriptioncompk4sduaec progalleryinlinestylestranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d203896a3b4c28b7b7a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d203896a3b4c28b7b7a84133c183b3idx8ingroupidx1dtoid74d203896a3b4c28b7b7a84133c183b3width1015height500itemid74d203896a3b4c28b7b7a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamiento255compk4sduaec30px14emstylekao3jox4navcontainercenterdirectiontrabajo 1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667dd8ed47ac817a438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667dd8ed47ac817a438fc58bc077idx13ingroupidx1dtoid1503667dd8ed47ac817a438fc58bc077width800height500itemid1503667dd8ed47ac817a438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaablackcomo yotitlepginaspagofacil westerncursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur autodisplaynone255 1positionstaticboxshadow000 0integraltitlewestern union ystylekao3jox4repeaterbuttonlabelstylekao3jox4navcontainerarrowstylekao3jox4navcontainerrightdirection249 249 1backgroundcolorrgba255galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcururlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur0 0compk4sduaecfff strokewidthn ngalleryitemcontainerprogallerymobileindicator galleryslideshowinfogalleryitemwrapper galleryitemhover svgnbuttoncompk4sduaec progalleryinlinestyles galleryitemcontainerformatwoffdigitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2020202020202020202mesa de tranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d203896a3b4c28b7b7a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d203896a3b4c28b7b7a84133c183b3idx8ingroupidx1dtoid74d203896a3b4c28b7b7a84133c183b3width1015height500itemid74d203896a3b4c28b7b7a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamientolinktargetblanktypewixdatapageidtyabftargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800focalpoint02706250369filenameportadareelagenciajpgnamecb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgmediaurlcb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left0width374height235offsettop0left0right370bottom231groupoffsettop0left0right37429693251533735bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left0right374bottom235visibletruerenderedtruerequiredtrueidg1cb9e63992fce44129fd153f46eb2d7d1idx1stripidx1instripidx2islastgroupfalseitemsidcb9e63992fce44129fd153f46eb2d7d1idx1ingroupidx1dtoidcb9e63992fce44129fd153f46eb2d7d1width800height500itemidcb9e63992fce44129fd153f46eb2d7d1securefalseorderindex15928626346380024metadatadescriptioneventostitlereellinktargetblanktypewixdatapageidtyabetargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenameportadaeventosjpgnamecb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgmediaurlcb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left374width374height235offsettop0left374right744bottom231groupoffsettop0left374right7482969325153374bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left374right748bottom235visibletruerenderedtruerequiredtrueidg2169fb0f365bd4335b2179c3ffcae680aidx2stripidx1instripidx3islastgrouptrueitemsid169fb0f365bd4335b2179c3ffcae680aidx2ingroupidx1dtoid169fb0f365bd4335b2179c3ffcae680awidth500height500itemid169fb0f365bd4335b2179c3ffcae680asecurefalseorderindex1592863432266metadatadescriptionestrategia1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667dd8ed47ac817a438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667dd8ed47ac817a438fc58bc077idx13ingroupidx1dtoid1503667dd8ed47ac817a438fc58bc077width800height500itemid1503667dd8ed47ac817a438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa2018titleheronormal normal normal15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationstylekailq3onlabelimportantfontnormal normal normalcustombuttonwrapper buttoncompk4sduaecy pago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula15px14emborderstylesolidbordercolorrgba249 2490compk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles15px18pxherramientassocialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesaamarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename20202jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c33167430fb55b93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c33167430fb55b93d413a7a386idx11ingroupidx1dtoid7eac53c33167430fb55b93d413a7a386width1200height1200itemid7eac53c33167430fb55b93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar 2018titlehero15px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration compk4sduaec255 1 stylekao3jox4navcontainer1backgroundcolorrgba255 255000000colorrgb0nninfosvgtypeshapeviewbox0 0helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationimportantleftauto importantzindex50selectdatapreviewerror stylekao3jox4navcontainerarrowgalleryitemhoverdefaultforcehoverbeforecompk4sduaec progalleryinlinestylesformatttf8borderwidth2px borderstylesolidbordercolorrgba249 249redes980px 05galleryitemcontainer galleryitembottominfo0fontnormal normal000000colorrgb0 0helveticaw01lighthelveticaw02lightsansseriftextdecoration compk4sduaec progalleryinlinestylespagodigitaltitleblackgalleryitemhoverbeforeitemopacityinfoelementcustombuttonwrapperdivprogalleryparentcontaineronlinecliccursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur3fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarstylekao3jox4navcontainersvgcontainer255 255fff strokebuttoncompk4sduaecstylekailq3onlinkyselectdatapreviewfocusmarginleftnormal 15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationacompk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles7backgroundcolorrgba255 235 0dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowinfoelementdescriptioncompk4sduaec progalleryinlinestylesofficetitlemercedesbenzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec433jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa481f7403a82d74219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa481f7403a82d74219a877e405idx10ingroupidx1dtoid7b428aa481f7403a82d74219a877e405width1015height500itemid7b428aa481f7403a82d74219a877e405securefalseorderindex1592863529831metadatadescriptionmedia amarillatitlepginasimportantcompk4sduaec progalleryinlinestyles galleryitemcontainersvgfill fffprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfoamarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename20202jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c33167430fb55b93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c33167430fb55b93d413a7a386idx11ingroupidx1dtoid7eac53c33167430fb55b93d413a7a386width1200height1200itemid7eac53c33167430fb55b93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakarfontface0compk4sduaeccustombuttonwrapper buttoncompk4sduaec progalleryinlinestylesgalleryitemtitlecompk4sduaec000000color000000lb1itemscontaineruleaseinfoelementtitlecompk4sduaec progalleryinlinestyles0 110rgba0 0 0para ganartitlestanley blackinfoelementtitleitemfontslideshow normalmarginleft calc100fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacil westernfullscreenviewfullscreenbrightprofullscreeninlinestylesdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration249 1backgroundcolorrgba255 255galleryslideshowinfofullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav255 255 importantcompk4sduaecimportantinotprogallerylovednotinfoelementlovedcompk4sduaec progalleryinlinestylesbackgroundcolorrgba255 235tiendan n nninfosvgtypeshapeviewbox0strokewidth 0dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0 0 0fontnormalnormal normal 22px14emherramientas elctricastitlestanleylinktargetblanktypewixdatapageidtyab7targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2020202020202020202mesaprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfovisitantesbuttonnotprogallerylovednotinfoelementlovedcompk4sduaecpago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulaselectfocus0compk4sduaec profullscreenwrapper15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0 0galleryslideshowinfo galleryitemtitlecompk4sduaec progalleryinlinestylesstrc1inlinecontentstylekao3jox4navcontainerarrowstylekao3jox4navcontainercenterdirectionstrokeamarillatitlepginasfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocial9profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialcustombuttonwrapper1235 05calc100 980pxofficetitlemercedesbenzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec433jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa481f7403a82d74219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa481f7403a82d74219a877e405idx10ingroupidx1dtoid7b428aa481f7403a82d74219a877e405width1015height500itemid7b428aa481f7403a82d74219a877e405securefalseorderindex1592863529831metadatadescriptionmedia amarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename20202jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c33167430fb55b93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c33167430fb55b93d413a7a386idx11ingroupidx1dtoid7eac53c33167430fb55b93d413a7a386width1200height1200itemid7eac53c33167430fb55b93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakarprogalleryinlinestyles00 0 importantcompk4sduaecgalleryslideshowinfo galleryitemdescriptioncompk4sduaecstylekao3jox4navcontainergalleryslideshowinfo svgofficetitlemercedesbenzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec433jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa481f7403a82d74219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa481f7403a82d74219a877e405idx10ingroupidx1dtoid7b428aa481f7403a82d74219a877e405width1015height500itemid7b428aa481f7403a82d74219a877e405securefalseorderindex1592863529831metadatadescriptionmedia0 0fontnormal normalborderstylesolidbordercolorrgba249 249 249dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshowpago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacilpositionfixed importantleftautoselecthovercursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpngnormal 15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationfill fff stroke0fontnormal normal normalcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowsolid rgba0unahelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compk4sduaec progalleryinlinestylespositionabsolutetop0right0bottom0left0deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8ac1947f9bf7c3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8ac1947f9bf7c3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8ac1947f9bf7c3fb3a6a125aawidth1015height500itemid90dc5ac8ac1947f9bf7c3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhacunionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaanormal 30px14emgalleryitemwrapper galleryitemgalleryitemvideotus imgenesblack and deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8ac1947f9bf7c3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8ac1947f9bf7c3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8ac1947f9bf7c3fb3a6a125aawidth1015height500itemid90dc5ac8ac1947f9bf7c3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhacgalleryitembottominfoprogalleryinlinestyles galleryitemcontainer galleryitemtopinfonormal 15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0normal 15px18pxcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpnggalleryslideshowinfo galleryitemdescriptioncompk4sduaec progalleryinlinestylesnormal normalgalleryitemgalleryitemvideostylekao3jox4navcontainerrightdirectiondinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb0normal normal 30px14emdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 000000colorrgb0para000000formatwoff2dinnextw01lightdinnextw02lightdinnextw10lightsansserif color767676helveticaw01lighthelveticaw02lightsansseriftextdecoration compk4sduaec22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationmtodosolid rgba0 0displayblockoverflowhiddenstylekao3jox4navcontainerarrow stylekao3jox4navcontainersvgcontainerwestern unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaagalleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompk4sduaecdeckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8ac1947f9bf7c3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8ac1947f9bf7c3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8ac1947f9bf7c3fb3a6a125aawidth1015height500itemid90dc5ac8ac1947f9bf7c3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac como yotitlepginasspottitlemercedesbenzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulasummerspot2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1eecb45ba85d77d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1eecb45ba85d77d4052a6a64cidx4ingroupidx1dtoidc599c0d1eecb45ba85d77d4052a6a64cwidth1280height720itemidc599c0d1eecb45ba85d77d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientas para204 204galleryitemcontainer galleryslideshowinfogalleryitemtextcompk4sduaec progalleryinlinestylesunionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa ydinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow 000000colorrgb0pgina22px14emstylekapovjd1bgunionimportantleftautonormalstylekailq3onlabelwrappergalleryitemhoverbackgroundcolorrgba255importantcompk4sduaec progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgalleryitemtitlecompk4sduaec progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorhazmtodo de pagointegraltitlewestern uniontu mtodo15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 000000colorrgb0nopmginotprogallerylovedcompk4sduaecpara ganartitlestanleydigitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2020202020202020202mesagalleryitemtitlecompk4sduaec progalleryinlinestylescolor ffffffunionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a038540e3814d72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a038540e3814d72e00c29c28eidx14ingroupidx1dtoid5301fc0a038540e3814d72e00c29c28ewidth800height500itemid5301fc0a038540e3814d72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa y creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulagalleryitemcontainerprogallerymobileindicator galleryitembottominfonninfosvgtypeshapeviewbox0solidtrabajo0 0 importantfontnormalimportantfontnormalfcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratulaprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapperprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialsocialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesa de trabajoinfoelementdescriptioncompk4sduaecfontface fontfamilystroke fff strokewidthyotitlepginasdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compk4sduaec profullscreenwrappertusautooverflowhiddendisplayblockimportantcompk4sduaecgalleryitemcontainer galleryitemwrapper galleryslideshowinfoprofullscreenwrappernormal 50px14em1backgroundcolorrgba255 255 2550 importantcompk4sduaec progalleryinlinestylescalc100 980px 05255 255compk4sduaecacompk4sduaec profullscreenwrappercomo1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667dd8ed47ac817a438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667dd8ed47ac817a438fc58bc077idx13ingroupidx1dtoid1503667dd8ed47ac817a438fc58bc077width800height500itemid1503667dd8ed47ac817a438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewestern unionwiximage positionabsolutetop0right0bottom0left0urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblockformatttf fontfacetranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d203896a3b4c28b7b7a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d203896a3b4c28b7b7a84133c183b3idx8ingroupidx1dtoid74d203896a3b4c28b7b7a84133c183b3width1015height500itemid74d203896a3b4c28b7b7a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamiento de herramientasbackgroundcolor ffffffcompk4sduaec progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorfontnormaltransform22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compk4sduaecpagofacilonormal 22px14emsrcstroke fffinfoelementcustombuttonwrapper buttoncompk4sduaec progalleryinlinestylesstylekao3jox4navcontainerleftdirectiongalleryitemhoverdefaultforcehoverbeforecompk4sduaecfff stroke fffinotprogallerylovedcompk4sduaec profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesprogalleryinlinestyles galleryitemcontainer galleryitembottominfodinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compk4sduaecfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialwesternease 0sselectdatapreviewerrorgalleryitemcontainer galleryitemwrapper galleryitemhoverintegraltitlewestern15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationfontgalleryitemhoverdefaultnothidehoverbeforebackground000000galleryitemdescriptioncompk4sduaecnninfosvgtypeshapeviewbox0 0 200compk4sduaec progalleryinlinestyles galleryitemcontainer16px14em000000colorrgb0 0 0calc100255 importantcompk4sduaecnormal 15px14emnormal 22px27pxfff strokewidth 0unimgenesamarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename20202jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c33167430fb55b93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c33167430fb55b93d413a7a386idx11ingroupidx1dtoid7eac53c33167430fb55b93d413a7a386width1200height1200itemid7eac53c33167430fb55b93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar255 importantcompk4sduaec progalleryinlinestyles22px27pxmargin0lineheightnormalletterspacingnormal4backgroundcolorfullscreensocial0 0compk4sduaec profullscreenwrapper50px14em0pxmargin0lineheightnormalletterspacingnormal txtnewn nninfosvgtypeshapeviewbox0profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebar097positionfixed importantleftauto importantzindex50rgba0 0objectcolor767676

Longtail Keyword Density for Grupopmg.com.ar

KeywordsOccurences
margin-left calc100 980px43
calc100 980px 0543
normal normal normal32
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
normal normal 15px14em24
gallery-item-container gallery-item-wrapper gallery-item-hover14
importantfontnormal normal normal14
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
font normal normal11
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
custom-button-wrapper buttoncomp-k4sduaec pro-galleryinline-styles10
0 importantfontnormal normal9
0 0 importantfontnormal9
importantcomp-k4sduaec pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
0 importantcomp-k4sduaec pro-galleryinline-styles8
buttoncomp-k4sduaec pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
buttoncomp-k4sduaec pro-galleryinline-styles gallery-item-container8
normal normal 15px18px8
formatttf font-face font-family7
importantcomp-k4sduaec pro-galleryinline-styles gallery-item-container7
000000colorrgb0 0 07
comp-k4sduaec pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
comp-k4sduaec pro-galleryinline-styles gallery-item-container7
rgba0 0 07
normal 15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
info-element-custom-button-wrapper buttoncomp-k4sduaec pro-galleryinline-styles6
y pago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula6
pago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacil6
fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacil western6
union y pago6
integraltitlewestern union y6
normal normal 30px14em6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesa de trabajo6
para redes socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesa6
para ganartitlestanley black6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-k4sduaec5
04s ease 0s5
gallery-item-descriptioncomp-k4sduaec pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
normal normal 22px27px5
gallery-item-titlecomp-k4sduaec pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-titlecomp-k4sduaec pro-galleryinline-styles gallery-item-container5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-k4sduaec pro-galleryinline-styles5
normal 15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
gallery-item-descriptioncomp-k4sduaec pro-galleryinline-styles gallery-item-container5
normal 15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb04
acomp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb0 04
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-k4sduaec pro-galleryinline-styles4
235 0 importantcomp-k4sduaec4
inotpro-gallery-lovedcomp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
n nninfosvgtypeshapeviewbox0 04
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-k4sduaec4
n n nninfosvgtypeshapeviewbox04
255 importantcomp-k4sduaec pro-galleryinline-styles4
255 255 importantcomp-k4sduaec4
gallery-item-wrapper gallery-slideshow-info svg4
255 255 14
solid rgba0 04
1background-colorrgba255 255 2554
gallery-slideshow-info gallery-item-descriptioncomp-k4sduaec pro-galleryinline-styles4
249 1background-colorrgba255 2554
249 249 1background-colorrgba2554
border-stylesolidborder-colorrgba249 249 2494
border-width2px border-stylesolidborder-colorrgba249 2494
positionstaticbox-shadow000 0 04
255 1 style-kao3jox4navcontainer4
gallery-item-wrapper gallery-item-hover svg4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-k4sduaec pro-galleryinline-styles4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-k4sduaec4
normal 22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow 000000colorrgb0 04
info-element-title--itemfontslideshow normal normal4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
gallery-slideshow-info gallery-item-titlecomp-k4sduaec pro-galleryinline-styles4
0 0 importantcomp-k4sduaec4
normal normal 50px14em3
nninfosvgtypeshapeviewbox0 0 2003
normal normal 22px14em3
normal normal 16px14em3
pagofacil western unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa3
mtodo de pago3
spottitlemercedes-benzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula-summerspot-2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4ingroupidx1dtoidc599c0d1-eecb-45ba-85d7-7d4052a6a64cwidth1280height720itemidc599c0d1-eecb-45ba-85d7-7d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientas para ganartitlestanley3
black and deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aawidth1015height500itemid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac3
western unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa y3
deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aawidth1015height500itemid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac como yotitlepginas3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
tranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d20389-6a3b-4c28-b7b7-a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d20389-6a3b-4c28-b7b7-a84133c183b3idx8ingroupidx1dtoid74d20389-6a3b-4c28-b7b7-a84133c183b3width1015height500itemid74d20389-6a3b-4c28-b7b7-a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamiento de herramientas3
officetitlemercedes-benzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec43-3jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa4-81f7-403a-82d7-4219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa4-81f7-403a-82d7-4219a877e405idx10ingroupidx1dtoid7b428aa4-81f7-403a-82d7-4219a877e405width1015height500itemid7b428aa4-81f7-403a-82d7-4219a877e405securefalseorderindex1592863529831metadatadescriptionmedia amarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c3-3167-430f-b55b-93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c3-3167-430f-b55b-93d413a7a386idx11ingroupidx1dtoid7eac53c3-3167-430f-b55b-93d413a7a386width1200height1200itemid7eac53c3-3167-430f-b55b-93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar3
amarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c3-3167-430f-b55b-93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c3-3167-430f-b55b-93d413a7a386idx11ingroupidx1dtoid7eac53c3-3167-430f-b55b-93d413a7a386width1200height1200itemid7eac53c3-3167-430f-b55b-93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar 2018titlehero3
trabajo 1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667d-d8ed-47ac-817a-438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667d-d8ed-47ac-817a-438fc58bc077idx13ingroupidx1dtoid1503667d-d8ed-47ac-817a-438fc58bc077width800height500itemid1503667d-d8ed-47ac-817a-438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewestern3
1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667d-d8ed-47ac-817a-438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667d-d8ed-47ac-817a-438fc58bc077idx13ingroupidx1dtoid1503667d-d8ed-47ac-817a-438fc58bc077width800height500itemid1503667d-d8ed-47ac-817a-438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewestern union3
digitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2-02-02-02-02-02-02-02-02-02mesa de tranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d20389-6a3b-4c28-b7b7-a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d20389-6a3b-4c28-b7b7-a84133c183b3idx8ingroupidx1dtoid74d20389-6a3b-4c28-b7b7-a84133c183b3width1015height500itemid74d20389-6a3b-4c28-b7b7-a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamiento3
0 0comp-k4sduaec pro-fullscreen-wrapper3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock3
235 0 0973
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 000000colorrgb0 03
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
normal 15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
fff stroke-width 03
stroke fff stroke-width3
fff stroke fff3
fill fff stroke3
background-colorrgba255 235 03
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto3
0 0 13
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
255 255comp-k4sduaec pro-fullscreen-wrapper3
255comp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb0 0 0fontnormal3
0 0fontnormal normal3
0fontnormal normal normal3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-k4sduaec pro-fullscreen-wrapper3
comp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
0comp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
positionfixed importantleftauto importantz-index503
buttoncomp-k4sduaec pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa y creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula3
normal normal92
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator49
pro-galleryinline-styles gallery-item-container49
margin-left calc10043
calc100 980px43
980px 0543
0 041
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
normal 15px14em24
importantcomp-k4sduaec pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
buttoncomp-k4sduaec pro-galleryinline-styles16
importantfontnormal normal15
comp-k4sduaec pro-galleryinline-styles14
235 013
255 25511
font normal11
gallery-item-titlecomp-k4sduaec pro-galleryinline-styles10
gallery-item-descriptioncomp-k4sduaec pro-galleryinline-styles10
custom-button-wrapper buttoncomp-k4sduaec10
0 importantfontnormal9
000000colorrgb0 09
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color7676769
normal 15px18px8
font-face font-family8
0 importantcomp-k4sduaec8
normal bold7
rgba0 07
formatttf font-face7
margin0line-heightnormalletter-spacingnormal txtnew7
gallery-item-container gallery-item-bottom-info6
y creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula6
pagofacil western6
fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula pagofacil6
pago fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula6
y pago6
redes socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesa6
union y6
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration6
normal 30px14em6
gallery-item-container gallery-slideshow-info6
gallery-item-container gallery-item-top-info6
integraltitlewestern union6
info-element-custom-button-wrapper buttoncomp-k4sduaec6
para redes6
herramientas elctricastitlestanleylinktargetblanktypewixdatapageidtyab7targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02-02-02-02-02-02-02-02mesa6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
para ganartitlestanley6
como yotitlepginas6
ganartitlestanley black6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
04s ease6
normal 22px27px5
ease 0s5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb0 05
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-k4sduaec5
1 style-kao3jox4navcontainer5
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-k4sduaec5
255 255comp-k4sduaec5
255 importantcomp-k4sduaec4
color ffffff4
gallery-slideshow-info gallery-item-descriptioncomp-k4sduaec4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-k4sduaec4
gallery-item-hoverdefaultforce-hoverbeforecomp-k4sduaec pro-galleryinline-styles4
solid rgba04
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-k4sduaec4
info-element-titlecomp-k4sduaec pro-galleryinline-styles4
info-element-descriptioncomp-k4sduaec pro-galleryinline-styles4
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb04
nninfosvgtypeshapeviewbox0 04
n nninfosvgtypeshapeviewbox04
n n4
inotpro-gallery-lovedcomp-k4sduaec pro-fullscreen-wrapper4
acomp-k4sduaec pro-fullscreen-wrapper4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
inotpro-gallery-lovednotinfo-element-lovedcomp-k4sduaec pro-galleryinline-styles4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow 000000colorrgb04
249 2494
positionstaticbox-shadow000 04
txtnew ul4
info-element-title--itemfontslideshow normal4
204 2044
255 14
1background-colorrgba255 2554
249 1background-colorrgba2554
ffffffcolorrgb36 354
gallery-item-wrapper gallery-itemgallery-item-video4
gallery-slideshow-info svg4
border-stylesolidborder-colorrgba249 2494
gallery-item-hover svg4
border-width2px border-stylesolidborder-colorrgba2494
0 14
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-k4sduaec pro-galleryinline-styles4
gallery-slideshow-info gallery-item-titlecomp-k4sduaec4
background-color ffffff4
gallery-slideshow-info info-element-title--itemfontslideshow4
amarillatitlepginas amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c3-3167-430f-b55b-93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c3-3167-430f-b55b-93d413a7a386idx11ingroupidx1dtoid7eac53c3-3167-430f-b55b-93d413a7a386width1200height1200itemid7eac53c3-3167-430f-b55b-93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar3
western unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa3
1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667d-d8ed-47ac-817a-438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667d-d8ed-47ac-817a-438fc58bc077idx13ingroupidx1dtoid1503667d-d8ed-47ac-817a-438fc58bc077width800height500itemid1503667d-d8ed-47ac-817a-438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa integraltitlewestern3
trabajo 1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667d-d8ed-47ac-817a-438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667d-d8ed-47ac-817a-438fc58bc077idx13ingroupidx1dtoid1503667d-d8ed-47ac-817a-438fc58bc077width800height500itemid1503667d-d8ed-47ac-817a-438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa3
0 2003
amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c3-3167-430f-b55b-93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c3-3167-430f-b55b-93d413a7a386idx11ingroupidx1dtoid7eac53c3-3167-430f-b55b-93d413a7a386width1200height1200itemid7eac53c3-3167-430f-b55b-93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar 2018titlehero3
tu mtodo3
officetitlemercedes-benzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec43-3jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa4-81f7-403a-82d7-4219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa4-81f7-403a-82d7-4219a877e405idx10ingroupidx1dtoid7b428aa4-81f7-403a-82d7-4219a877e405width1015height500itemid7b428aa4-81f7-403a-82d7-4219a877e405securefalseorderindex1592863529831metadatadescriptionmedia amarillatitlepginas3
aumentadatitleremanlinktargetblanktypewixdatapageidtyab5targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight501width1015filenamereman-05jpgnamecb1de2cab4dae767344d51a36072bb530a98f9mv2jpgmediaurlcb1de2cab4dae767344d51a36072bb530a98f9mv2jpgdirectlinkdirectsharelinknullstylewidth389cubedwidth389height192cubedheight192top0bottomautoleft0rightautowidth389maxwidth1015outerwidth393infowidth0margins2ratio2025948103792415cropratio1iscroppedfalsecroptypefillheight192maxheight501outerheight196infoheight0grouptop41879124238977676left0width393height196offsettop41879124238977676left0right389bottom6107912423897767groupoffsettop41879124238977676left0right3929507543305557bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width393height196infoheight0infowidth0ratio20051020408163267top41879124238977676left0right393bottom6147912423897767visibletruerenderedtruerequiredtrueidg7136d7bd4-6597-4145-b381-651f1ff16473idx7stripidx3instripidx2islastgroupfalseitemsid136d7bd4-6597-4145-b381-651f1ff16473idx7ingroupidx1dtoid136d7bd4-6597-4145-b381-651f1ff16473width500height500itemid136d7bd4-6597-4145-b381-651f1ff16473securefalseorderindex1592863491643metadatadescriptioncontenidos digitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2-02-02-02-02-02-02-02-02-02mesa3
deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aawidth1015height500itemid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac como3
spottitlemercedes-benzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula-summerspot-2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4ingroupidx1dtoidc599c0d1-eecb-45ba-85d7-7d4052a6a64cwidth1280height720itemidc599c0d1-eecb-45ba-85d7-7d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientas para3
linktargetblanktypewixdatapageidtyabftargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800focalpoint02706250369filenameportada-reelagenciajpgnamecb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgmediaurlcb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left0width374height235offsettop0left0right370bottom231groupoffsettop0left0right37429693251533735bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left0right374bottom235visibletruerenderedtruerequiredtrueidg1cb9e6399-2fce-4412-9fd1-53f46eb2d7d1idx1stripidx1instripidx2islastgroupfalseitemsidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1idx1ingroupidx1dtoidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1width800height500itemidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1securefalseorderindex15928626346380024metadatadescriptioneventostitlereellinktargetblanktypewixdatapageidtyabetargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenameportada-eventosjpgnamecb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgmediaurlcb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left374width374height235offsettop0left374right744bottom231groupoffsettop0left374right7482969325153374bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left374right748bottom235visibletruerenderedtruerequiredtrueidg2169fb0f3-65bd-4335-b217-9c3ffcae680aidx2stripidx1instripidx3islastgrouptrueitemsid169fb0f3-65bd-4335-b217-9c3ffcae680aidx2ingroupidx1dtoid169fb0f3-65bd-4335-b217-9c3ffcae680awidth500height500itemid169fb0f3-65bd-4335-b217-9c3ffcae680asecurefalseorderindex1592863432266metadatadescriptionestrategia digitaltitleblack3
tus imgenes3
haz clic3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
importantleftauto importantz-index503
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
stroke-width 03
ultxtnew ol3
ol ul3
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur3
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock3
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur3
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto3
wix-image positionabsolutetop0right0bottom0left03
background-colorrgba255 2353
positionfixed importantleftauto3
selectdata-previewerror style-kao3jox4navcontainerarrow3
fill fff3
fff stroke3
stroke fff3
fff stroke-width3
style-kao3jox4navcontainerarrow style-kao3jox4navcontainersvgcontainer3
buttoncomp-k4sduaec pro-fullscreen-wrapper3
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
fontnormal normal3
0 0973
normal 22px14em3
normal 50px14em3
normal 16px14em3
255comp-k4sduaec pro-fullscreen-wrapper3
0 0fontnormal3
0fontnormal normal3
comp-k4sduaec pro-fullscreen-wrapper3
0 0comp-k4sduaec3
0comp-k4sduaec pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa y3
normal159
pro-galleryinline-styles111
0110
gallery-item-wrapper58
gallery-item-container49
gallery-item-containerpro-gallery-mobile-indicator49
0545
980px43
calc10043
margin-left43
background-color37
color36
gallery-slideshow-info32
pro-fullscreen-wrapper32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
130
gallery-item-hover28
15px14em25
importantcomp-k4sduaec22
positionabsolutetop0right0bottom0left022
para21
comp-k4sduaec20
y19
buttoncomp-k4sduaec19
txtnew18
importantfontnormal15
svg14
214
style-kao3jox4navcontainer13
font13
gallery-item-bottom-info12
312
gallery-item-top-info12
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif12
style-kao3jox4navcontainerarrow11
custom-button-wrapper10
info-element-custom-button-wrapper10
gallery-item-descriptioncomp-k4sduaec10
15px18px10
ul10
gallery-item-titlecomp-k4sduaec10
000000colorrgb09
pago9
color7676769
48
your8
tu8
font-face8
font-family8
src8
n8
formatwoff28
formatwoff8
formatttf8
ffffff8
58
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration8
solid8
margin0line-heightnormalletter-spacingnormal7
ol7
22px27px7
pmg7
rgba07
var7
bold7
ease7
important7
tus7
herramientas6
fff6
elctricastitlestanleylinktargetblanktypewixdatapageidtyab7targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02-02-02-02-02-02-02-02mesa6
digitalestitleirwinlinktargetblanktypewixdatapageidtyab6targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width500filename2-02-02-02-02-02-02-02-02-02mesa6
socialestitleprestigiolinktargetblanktypewixdatapageidtyabbtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width501filenameprestigiomesa6
amarillatitlepginas6
30px14em6
66
black6
2018titlehero6
style-kao3jox4navcontainerarrowstyle-kao3jox4navcontainerright-direction6
ganartitlestanley6
redes6
style-kao3jox4navcontainerarrowstyle-kao3jox4navcontainerleft-direction6
trabajo6
pagofacil6
como6
creatividadtitlegurlinktargetblanktypewixdatapageidtyabctargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula6
western6
04s6
integraltitlewestern6
yotitlepginas6
fcillinktargetblanktypewixdatapageidtyabdtargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula6
style-kao3jox4navcontainerarrowstyle-kao3jox4navcontainercenter-direction6
union6
digitaltitleblack6
if5
imgenes5
0px5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
255comp-k4sduaec5
transform5
overflowhidden5
no5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb05
ultxtnew5
0s5
divpro-gallery-parent-container5
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
border-stylesolidborder-colorrgba2494
b0b0b04
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow4
border-width2px4
000000color0000004
info-element-descriptioncomp-k4sduaec4
74
0000004
gallery-item-hoverdefaultforce-hoverbeforecomp-k4sduaec4
gallery-item-hoverdefaultnothide-hoverbeforebackground0000004
info-element-titlecomp-k4sduaec4
1background-colorrgba2554
gallery-item-text4
84
inotpro-gallery-lovedcomp-k4sduaec4
acomp-k4sduaec4
info-element-title--itemfontslideshow4
nninfosvgtypeshapeviewbox04
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-k4sduaec4
una4
style-kao3jox4repeaterbuttonlabel4
positionstaticbox-shadow0004
style-kailq3onlabelwrapper4
style-kailq3onlink4
style-kailq3onlabel4
lb1itemscontainer4
inotpro-gallery-lovednotinfo-element-lovedcomp-k4sduaec4
clic4
background-colorrgba2554
ffffffcolorrgb364
gallery-itemgallery-item-video4
o3
93
visitantes3
aumentadatitleremanlinktargetblanktypewixdatapageidtyab5targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight501width1015filenamereman-05jpgnamecb1de2cab4dae767344d51a36072bb530a98f9mv2jpgmediaurlcb1de2cab4dae767344d51a36072bb530a98f9mv2jpgdirectlinkdirectsharelinknullstylewidth389cubedwidth389height192cubedheight192top0bottomautoleft0rightautowidth389maxwidth1015outerwidth393infowidth0margins2ratio2025948103792415cropratio1iscroppedfalsecroptypefillheight192maxheight501outerheight196infoheight0grouptop41879124238977676left0width393height196offsettop41879124238977676left0right389bottom6107912423897767groupoffsettop41879124238977676left0right3929507543305557bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width393height196infoheight0infowidth0ratio20051020408163267top41879124238977676left0right393bottom6147912423897767visibletruerenderedtruerequiredtrueidg7136d7bd4-6597-4145-b381-651f1ff16473idx7stripidx3instripidx2islastgroupfalseitemsid136d7bd4-6597-4145-b381-651f1ff16473idx7ingroupidx1dtoid136d7bd4-6597-4145-b381-651f1ff16473width500height500itemid136d7bd4-6597-4145-b381-651f1ff16473securefalseorderindex1592863491643metadatadescriptioncontenidos3
mtodo3
1jpgnamecb1de2580b2de740164abebd23ed3e93c107c2mv2jpgmediaurlcb1de2580b2de740164abebd23ed3e93c107c2mv2jpgdirectlinkdirectsharelinknullstylewidth232cubedwidth232height231cubedheight231top0bottomautoleft0rightautowidth232maxwidth501outerwidth236infowidth0margins2ratio1002cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left0width236height235offsettop8332557335988073left0right232bottom10642557335988072groupoffsettop8332557335988073left0right23578754810620768bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width236height235infoheight0infowidth0ratio1004255319148936top8332557335988073left0right236bottom10682557335988072visibletruerenderedtruerequiredtrueidg131503667d-d8ed-47ac-817a-438fc58bc077idx13stripidx5instripidx2islastgroupfalseitemsid1503667d-d8ed-47ac-817a-438fc58bc077idx13ingroupidx1dtoid1503667d-d8ed-47ac-817a-438fc58bc077width800height500itemid1503667d-d8ed-47ac-817a-438fc58bc077securefalseorderindex1594907859871metadatadescriptioncampaa3
deckerlinktargetblanktypewixdatapageidtyab3targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight720width1280focalpoint067226565067226565filenamehpgblog002jpgnamecb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgmediaurlcb1de2c3080d45b22846d6a8e68c0fcc2a48a5mv2jpgdirectlinkdirectsharelinknullstylewidth319cubedwidth319height179cubedheight179top0bottomautoleft0rightautowidth319maxwidth1280outerwidth323infowidth0margins2ratio17777777777777777cropratio1iscroppedfalsecroptypefillheight179maxheight720outerheight183infoheight0grouptop23543558282208582left291width323height183offsettop23543558282208582left291right610bottom41443558282208585groupoffsettop23543558282208582left291right6138545058981172bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width323height183infoheight0infowidth0ratio17650273224043715top23543558282208582left291right614bottom41843558282208585visibletruerenderedtruerequiredtrueidg590dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5stripidx2instripidx3islastgrouptrueitemsid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aaidx5ingroupidx1dtoid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aawidth1015height500itemid90dc5ac8-ac19-47f9-bf7c-3fb3a6a125aasecurefalseorderindex1592863466077metadatadescriptionhac3
spottitlemercedes-benzlinktargetblanktypewixdatapageidtyab2targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenamecaratula-summerspot-2jpgnamecb1de23f291a210ff94871a8e4e68ed019656dmv2jpgmediaurlcb1de23f291a210ff94871a8e4e68ed019656dmv2jpgdirectlinkdirectsharelinknullstylewidth287cubedwidth287height179cubedheight179top0bottomautoleft0rightautowidth287maxwidth800outerwidth291infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight179maxheight500outerheight183infoheight0grouptop23543558282208582left0width291height183offsettop23543558282208582left0right287bottom41443558282208585groupoffsettop23543558282208582left0right29096905530830554bottom41879124238977676orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width291height183infoheight0infowidth0ratio15901639344262295top23543558282208582left0right291bottom41843558282208585visibletruerenderedtruerequiredtrueidg4c599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4stripidx2instripidx2islastgroupfalseitemsidc599c0d1-eecb-45ba-85d7-7d4052a6a64cidx4ingroupidx1dtoidc599c0d1-eecb-45ba-85d7-7d4052a6a64cwidth1280height720itemidc599c0d1-eecb-45ba-85d7-7d4052a6a64csecurefalseorderindex1592863456199metadatadescriptionherramientas3
officetitlemercedes-benzlinktargetblanktypewixdatapageidtyab8targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight3884width5826focalpoint0408685204086852filenamec43-3jpgnamecb1de2319a783f3295427f9cf9e10d8412c58emv2jpgmediaurlcb1de2319a783f3295427f9cf9e10d8412c58emv2jpgdirectlinkdirectsharelinknullstylewidth322cubedwidth322height214cubedheight214top0bottomautoleft0rightautowidth322maxwidth5826outerwidth326infowidth0margins2ratio15cropratio1iscroppedfalsecroptypefillheight214maxheight3884outerheight218infoheight0grouptop6147758019164845left0width326height218offsettop6147758019164845left0right322bottom8287758019164845groupoffsettop6147758019164845left0right32571989752348424bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width326height218infoheight0infowidth0ratio14954128440366972top6147758019164845left0right326bottom8327758019164845visibletruerenderedtruerequiredtrueidg107b428aa4-81f7-403a-82d7-4219a877e405idx10stripidx4instripidx2islastgroupfalseitemsid7b428aa4-81f7-403a-82d7-4219a877e405idx10ingroupidx1dtoid7b428aa4-81f7-403a-82d7-4219a877e405width1015height500itemid7b428aa4-81f7-403a-82d7-4219a877e405securefalseorderindex1592863529831metadatadescriptionmedia3
amarillaslinktargetblanktypewixdatapageidtyab9targetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width1015filename2-02-02jpgnamecb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgmediaurlcb1de2c62bf2e4441f42189d1d75251d432eecmv2jpgdirectlinkdirectsharelinknullstylewidth435cubedwidth435height214cubedheight214top0bottomautoleft0rightautowidth435maxwidth1015outerwidth439infowidth0margins2ratio203cropratio1iscroppedfalsecroptypefillheight214maxheight500outerheight218infoheight0grouptop6147758019164845left326width439height218offsettop6147758019164845left326right761bottom8287758019164845groupoffsettop6147758019164845left326right7653942613151154bottom8332557335988073orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width439height218infoheight0infowidth0ratio20137614678899083top6147758019164845left326right765bottom8327758019164845visibletruerenderedtruerequiredtrueidg117eac53c3-3167-430f-b55b-93d413a7a386idx11stripidx4instripidx3islastgrouptrueitemsid7eac53c3-3167-430f-b55b-93d413a7a386idx11ingroupidx1dtoid7eac53c3-3167-430f-b55b-93d413a7a386width1200height1200itemid7eac53c3-3167-430f-b55b-93d413a7a386securefalseorderindex1592863542899metadatadescriptiondakar3
un3
tienda3
haz3
linktargetblanktypewixdatapageidtyabftargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800focalpoint02706250369filenameportada-reelagenciajpgnamecb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgmediaurlcb1de249aefb1dd30e47efb29831a5a0d781e8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left0width374height235offsettop0left0right370bottom231groupoffsettop0left0right37429693251533735bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left0right374bottom235visibletruerenderedtruerequiredtrueidg1cb9e6399-2fce-4412-9fd1-53f46eb2d7d1idx1stripidx1instripidx2islastgroupfalseitemsidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1idx1ingroupidx1dtoidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1width800height500itemidcb9e6399-2fce-4412-9fd1-53f46eb2d7d1securefalseorderindex15928626346380024metadatadescriptioneventostitlereellinktargetblanktypewixdatapageidtyabetargetselftypepagelinksourcenameprivatetagsfileoriginuploadedheight500width800filenameportada-eventosjpgnamecb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgmediaurlcb1de2473d25e01e07409e8e218e3bec0f73dfmv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop0left374width374height235offsettop0left374right744bottom231groupoffsettop0left374right7482969325153374bottom23543558282208582orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top0left374right748bottom235visibletruerenderedtruerequiredtrueidg2169fb0f3-65bd-4335-b217-9c3ffcae680aidx2stripidx1instripidx3islastgrouptrueitemsid169fb0f3-65bd-4335-b217-9c3ffcae680aidx2ingroupidx1dtoid169fb0f3-65bd-4335-b217-9c3ffcae680awidth500height500itemid169fb0f3-65bd-4335-b217-9c3ffcae680asecurefalseorderindex1592863432266metadatadescriptionestrategia3
tranamecb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgmediaurlcb1de2f9efc4fdc46f4e1c86603b8c5fba4f01mv2jpgdirectlinkdirectsharelinknullstylewidth192cubedwidth192height192cubedheight192top0bottomautoleft0rightautowidth192maxwidth500outerwidth196infowidth0margins2ratio1cropratio1iscroppedfalsecroptypefillheight192maxheight500outerheight196infoheight0grouptop41879124238977676left393width196height196offsettop41879124238977676left393right585bottom6107912423897767groupoffsettop41879124238977676left393right5889845595267078bottom6147758019164845orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width196height196infoheight0infowidth0ratio1top41879124238977676left393right589bottom6147912423897767visibletruerenderedtruerequiredtrueidg874d20389-6a3b-4c28-b7b7-a84133c183b3idx8stripidx3instripidx3islastgrouptrueitemsid74d20389-6a3b-4c28-b7b7-a84133c183b3idx8ingroupidx1dtoid74d20389-6a3b-4c28-b7b7-a84133c183b3width1015height500itemid74d20389-6a3b-4c28-b7b7-a84133c183b3securefalseorderindex1592863502467metadatadescriptionlanzamiento3
pgina3
object3
online3
stroke3
fullscreen-social3
selectdata-previewhover3
importantz-index503
importantleftauto3
positionfixed3
style-kao3jox4navcontainercenter-direction3
style-kao3jox4navcontainerright-direction3
selectdata-previewerror3
selectdata-errortrue3
selectdata-previewfocus3
selectfocus3
selecthover3
style-kapovjd1bg3
style-kao3jox4navcontainerleft-direction3
style-kao3jox4navcontainersvgcontainer3
displaynone3
wfontcb1de21281807f72cd42ed861fc99dfbcd9e8fwf1281807f72cd42ed861fc99dforiggothamroundedbook3
fontnormal3
border-radius03
22px14em3
50px14em3
16px14em3
new3
topautobottom03
strc1inlinecontent3
fullscreen-mobile-bar3
fill3
fullscreen-nav3
fullscreen-side-bar-social3
0comp-k4sduaec3
0fontnormal3
gallery-item-hoverbefore--itemopacity3
0973
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
103
stroke-width3
somos3
strc1data-responsive3
13px3
wix-image3
displayblockoverflowhidden3
auto3
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur3
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng3
autooverflowhiddendisplayblock3
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur3
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng3
oldirrtl3
unionjpgnamecb1de2db33b62808e64db6afd2368a8df124b8mv2jpgmediaurlcb1de2db33b62808e64db6afd2368a8df124b8mv2jpgdirectlinkdirectsharelinknullstylewidth370cubedwidth370height231cubedheight231top0bottomautoleft0rightautowidth370maxwidth800outerwidth374infowidth0margins2ratio16cropratio1iscroppedfalsecroptypefillheight231maxheight500outerheight235infoheight0grouptop8332557335988073left236width374height235offsettop8332557335988073left236right606bottom10642557335988072groupoffsettop8332557335988073left236right6101198372953417bottom10685806319083958orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width374height235infoheight0infowidth0ratio15914893617021277top8332557335988073left236right610bottom10682557335988072visibletruerenderedtruerequiredtrueidg145301fc0a-0385-40e3-814d-72e00c29c28eidx14stripidx5instripidx3islastgrouptrueitemsid5301fc0a-0385-40e3-814d-72e00c29c28eidx14ingroupidx1dtoid5301fc0a-0385-40e3-814d-72e00c29c28ewidth800height500itemid5301fc0a-0385-40e3-814d-72e00c29c28esecurefalseorderindex1594907859873metadatadescriptioncampaa3

Grupopmg.com.ar Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Grupo-3r.com
grupo-3r.com
Grupo-4.com
Grupo4 – Soluciones Integrales
Grupo-aberdeen.com
Grupo Aberdeen www.pqf-elsalvador.com
Grupo-ac.com
Index of /
Grupo-acura.com
Grupo Acura - Tanques Estacionarios en Av. Azcapotzalco 696 Int. 10-E, Col. Centro, Azcapotzalco, Ciudad De México, Distrito Federal - Sección Amarilla
Grupo-aei.com
Inicio - Grupo Análisis e Investigación
Grupo-agua.com
Ozono para aire | Grupo Agua
Grupo-aires.com
Clases de pilates en Los Hornos con Grupo Aires

Recently Updated Websites

Nakamakina.com 1 second ago.Pictordesign.com 3 seconds ago.Mrandmrsstirling.com 4 seconds ago.Fotopoz.com 4 seconds ago.Voh5.com 4 seconds ago.Microflydrones.com 5 seconds ago.Mini-itx.com 5 seconds ago.Xpmods.net 6 seconds ago.Hotel-deima.ru 6 seconds ago.Shop.radiocontrolproducts.net 7 seconds ago.Oohboobsmovies.com 7 seconds ago.027out.com 8 seconds ago.Southtexasservicegroup.net 8 seconds ago.Ontarioschoolrankings.com 8 seconds ago.Bqengineers.com 8 seconds ago.Arktd.com 9 seconds ago.Litchfieldpolox.com 9 seconds ago.Hubhostel.com 10 seconds ago.Kitsaphotyoga.com 10 seconds ago.Doombot.com 10 seconds ago.Consumerdebtcounselors.com 11 seconds ago.Waste-whoever.xyz 11 seconds ago.Bren1988.com 11 seconds ago.Coiwo.com 11 seconds ago.G3soluciones.com 12 seconds ago.Sabaxter.com 12 seconds ago.Gotmailkeller.com 12 seconds ago.Hicksautoperformance.com 12 seconds ago.Cowquest.com 12 seconds ago.Coimbatorepages.com 13 seconds ago.