News, sport and opinion from the Guardian's UK edition | The Guardian

Safety: High trust score
Year Founded: before Aug
Global Traffic Rank: 541
Estimated Worth: $35,200,440
Category: News and Media

Latest news, sport, business, comment, analysis and reviews from the Guardian, the world's leading liberal voice



Domain summary

Last updated
2020-11-05
Domain label
guardian
Domain extension
co.uk
Domain registered:
before Aug-1996
Domain updated:
31-Oct-2019
Global Traffic Rank
541
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$35,200,440
Estimated daily income
$32,593
Estimated monthly income
$991,370

Rank summary

How is guardian.co.uk ranked relative to other sites:

Percentage of visits to guardian.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Guardian.co.uk registered?
A: Guardian.co.uk was registered before Aug-1996 on Thursday, January 1, 1970.
Q: When was the WHOIS for Guardian.co.uk last updated?
A: The WHOIS entry was last updated 1 year, 6 months, 1 week, 5 days, 13 hours, 35 minutes, 10 seconds ago on Thursday, October 31, 2019.
Q: What are Guardian.co.uk's nameservers?
A: DNS for Guardian.co.uk is provided by the following nameservers:
  • dns1.p02.nsone.net
  • dns2.p02.nsone.net
  • dns3.p02.nsone.net
  • dns4.p02.nsone.net
  • ns01.theguardiandns.com
  • ns02.theguardiandns.com
  • ns03.theguardiandns.com
  • ns04.theguardiandns.com
Q: Who is the registrar for the Guardian.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Guardian.co.uk?
A: Guardian.co.uk ranks 541 globally on Alexa. Guardian.co.uk has a High trust score, and a Statvoo Rank of A.
Q: How many people visit Guardian.co.uk each day?
A: Guardian.co.uk receives approximately 4,074,074 visitors and 32,592,592 page impressions per day.
Q: What IP address does Guardian.co.uk resolve to?
A: Guardian.co.uk resolves to the IPv4 address 151.101.129.111.
Q: In what country are Guardian.co.uk servers located in?
A: Guardian.co.uk has servers located in the United States.
Q: What webserver software does Guardian.co.uk use?
A: Guardian.co.uk is powered by webserver.
Q: Who hosts Guardian.co.uk?
A: Guardian.co.uk is hosted by Consortium GARR in United States.
Q: How much is Guardian.co.uk worth?
A: Guardian.co.uk has an estimated worth of $35,200,440. An average daily income of approximately $32,593, which is roughly $991,370 per month.

Guardian.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Guardian.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Guardian.co.uk

H1 Headings

4 :
  1. News, sport and opinion from the Guardian's UK edition
  2. Progressive journalism, powered by subscribers
  3. Guardian Labs
  4. Daisy Chain

H2 Headings

30 :
  1. Palette styles new do not delete
  2. US elections 2020
  3. Headlines
  4. Coronavirus
  5. Coronavirus data
  6. Coronavirus UK
  7. Spotlight
  8. Today in Focus
  9. Podcast Nearing the finish line in the race for a Covid-19 vaccine
  10. Listen to previous episodes
  11. Opinion
  12. Letters treat
  13. Sport
  14. Contact the Guardian
  15. From the UK
  16. Around the world
  17. Digital subscription
  18. Climate crisis
  19. Video
  20. Culture
  21. culture-treat
  22. ‘Why would I ever go back to shopping new?’ How vintage has become the future of buying ethically
  23. 'People want a job with purpose' Why businesses are becoming more sustainable
  24. Wood, time and a little magic Why making a great single malt is an art
  25. 'I can’t wait until I’m tall enough to go indoor rock climbing' An eight-year-old's guide to St Albans
  26. Lifestyle
  27. No Ball Games
  28. Take part
  29. Explore
  30. In pictures

H3 Headings

122 :
  1. Live US election 2020: Biden nearer to victory threshold but race still too close to call
  2. Live US election 2020: Biden nearer to victory threshold but race still too close to call
  3. US elections 2020 What we know so far about the results
  4. US elections 2020 What we know so far about the results
  5. Supreme court Could Trump really settle US election result in court?
  6. Supreme court Could Trump really settle US election result in court?
  7. 'Count every vote' Protesters take to streets across US as ballots tallied
  8. 'Count every vote' Protesters take to streets across US as ballots tallied
  9. Democracy in Trumpland: I won because I say so
  10. Democracy in Trumpland: I won because I say so
  11. Coronavirus Police warn public in England to expect tougher crackdown on Covid lockdown breaches
  12. Guardian morning briefing Joe Biden with one hand on the prize. Get up to speed quickly
  13. Economy Bank of England launches new £150bn stimulus package
  14. Dorset Mega henge may be ‘last hurrah’ of stone-age builders
  15. Cancer Four-week treatment delay raises death risk by 10% – study
  16. Climate change UK campaigners set out plan to meet Paris agreement and beat Covid recession
  17. Middle East Israeli forces leave 41 children homeless after razing Palestinian village, UN says
  18. Charles Spencer Diana's brother demands inquiry over 'deceit' that led to BBC interview
  19. TfL Tory London mayoral candidate criticised over misleading bailout 'facts' site
  20. That was close! California kayakers nearly swallowed by humpback
  21. Live Coronavirus: England begins lockdown; Russia, Poland, Austria, Switzerland see record case rises
  22. Live Coronavirus: England begins lockdown; Russia, Poland, Austria, Switzerland see record case rises
  23. 'Save nothing for best' Guardian readers on lessons of lockdown
  24. 'Save nothing for best' Guardian readers on lessons of lockdown
  25. Analysis Years of underfunding leave NHS ‘woefully short' for Covid second wave
  26. Analysis Years of underfunding leave NHS ‘woefully short' for Covid second wave
  27. Lockdown China bans non-Chinese travellers coming from UK
  28. Lockdown China bans non-Chinese travellers coming from UK
  29. Unemployment Up to 3,500 jobs at risk at Sainsbury's as firm cuts 400 Argos stores
  30. Retail Lockdown extension would be 'catastrophic' for industry
  31. Covid-19 NHS leaders warn of surge in serious cases in England
  32. Christmas Only 'small chance' Oxford vaccine will be ready
  33. ‘To the skies and stars!’ The man building our jetpack future – in tribute to his Dad
  34. Rocky Horror's Richard O'Brien I should be dead. I've had an excessive lifestyle
  35. The long read Under pressure: why athletes choke
  36. Do go back to Dalston Ridley Road market's black heritage
  37. Scatalogical science How poo analysis could help save endangered species
  38. City canvas Walking Manchester’s new self-guided art trail
  39. Science Weekly Investigating the historic eruption of Mount Vesuvius
  40. Sit! Stay! Get off my Zoom call! How to work from home – when your pet won’t let you
  41. Lockdown will be tough for shops like mine, but there remains a shred of hope
  42. In a data-obsessed world, the power of observation must not be forgotten
  43. The pollsters were wrong – again. Here's what we know so far
  44. Don't underestimate the threat to American democracy at this moment
  45. The Guardian view Tory lockdown sceptics: a dangerous trend
  46. Boris and Keir lock tepid horns on lockdown in parliament
  47. 'Not at this level' Solskjær rues defensive lapses in Basaksehir defeat
  48. Relentless Bayern have mastered art of lockdown football
  49. Tennis Nadal shakes off rust to beat López in Paris and join ATP's 1,000 club
  50. Netballer Ama Agbeze At times my only aim was to get out of bed
  51. Football FA under fire for diversity code that excludes disabled people
  52. Football Sakho wins 'substantial damages' from Wada over drugs claims
  53. Football Mourinho says rival players go over 'when somebody blows on them'
  54. NFL mid-season awards Wilson, Murray and a new Super Bowl pick
  55. HMRC Six people arrested for alleged fraud in Covid support schemes
  56. 'Spy cops' scandal Ex-wives of undercover police tell of marriages ‘based on lies’
  57. Lloyds Bank to cut 1,070 jobs despite £1bn third-quarter profits
  58. Matt Ratana Met chief pays tribute to 'inspirational' police officer
  59. Hospitals NHS to go back to highest alert level as patient numbers rise
  60. Belmarsh Prison watchdog investigates death of Julian Assange friend
  61. Hampshire Authorities failed to protect girl stabbed to death by abuser, review finds
  62. US election PM refuses to comment on Trump's call to stop vote counting
  63. Business Shares in London and New York rise as US election concerns fade
  64. Hamish First polar bear born in UK in 25 years moved from Scotland to Yorkshire
  65. Ethiopia Fighting reported after PM responds to 'attack' by regional ruling party
  66. Space Burst of radio waves in Milky Way probably came from neutron star
  67. 'Filled with dogs' Tiny Japanese home crammed with 164 starving pets
  68. US elections 2020 Polling industry the big loser as 2016 debacle repeats itself
  69. 'Prevent, discourage, confront' South American states tackle Chinese trawlers
  70. Turkey Country resists calls for tougher measures to tackle Covid surge
  71. Jordan Country suffers Covid surge after early success against virus
  72. North Korea Country bans smoking in public places to safeguard 'hygienic living'
  73. Social media Facebook and Twitter take emergency steps against Trump false victory claims
  74. Silk Road Bitcoins worth $1bn change hands after seven years
  75. US Crisis breaks open generational rifts in families
  76. Weather 2020 likely to be among warmest years on record despite La Niña
  77. 'We don't have time to lose' Plans for coral ark to help save the world's reefs
  78. US Deluged by floods, America’s ‘oldest city' struggles to save landmarks from climate crisis
  79. Black voting power The fight for one of America’s most segregated cities
  80. Explainer Why Biden calls Trump a 'climate arsonist'
  81. Anywhere but Washington God and the GOP: will conservative evangelicals stay loyal to Trump?
  82. Space tourism Why hasn't it taken off?
  83. Anywhere but Washington Broken promises and alternative facts: how Trump failed Ohio
  84. Black enough? Why the first US cowboys were black
  85. About Endlessness review Mesmerising odyssey to the heart of existence
  86. Book of the day Mr Wilder & Me by Jonathan Coe review – the director's cut
  87. Nuclear review Escape to the post-apocalyptic country
  88. Review roundup The best recent poetry
  89. Bookshop.org is what the publishing world has been waiting for
  90. The occult's return to art Before, you'd have been laughed out of the gallery
  91. Your problems Caught between BT and Openreach over our cut telephone line
  92. Leading questions 'During my husband's illness, everything has fallen to me. How can I stop feeling trapped?'
  93. Doughnuts How the sweet treat became Australia's symbol of Covid-hope
  94. I put my own makeup on for the first time - and saw my face in a whole new light
  95. Raise the root Delicious ways to use sweet potato, from curries to cheesecakes
  96. iPhone 12 Pro review Not quite worth the extra cost
  97. US elections 2020 How will you be following the election?
  98. Tell us Is your UK swimming pool facing permanent closure because of coronavirus?
  99. UK coronavirus Did you learn a creative skill during the first lockdown?
  100. Education Has your child had to self-isolate from a UK school because of coronavirus?
  101. 'See you on the other side' Bustling Ipswich braces for England's lockdown
  102. Politics Weekly Extra Trump calls foul play as Biden takes Wisconsin
  103. Pakistan Lahore’s metro line opened to fanfare – but what is the real cost of China's 'gift'?
  104. Love in the time of Covid From weddings to help for rough sleepers
  105. Wombat's deadly bums How they use their 'skull-crushing' rumps to fight, play and flirt
  106. Pass notes New moon? Scientists claim the Earth’s satellite may have a ‘dead ringer’
  107. Picture essay Anxiety, uncertainty and empty streets on election night in New York City
  108. Prints for Nature Buy a photo to help protect people and wildlife
  109. Excitement and despair The best pictures of US election night
  110. A frontline worker trapped in a hospital Hannah Grace Deller's best photograph
  111. Autumn colours and a golden monkey Wednesday's best photos
  112. Sloane Square sensations Scenes from the Royal Court
  113. Live US election live: Joe Biden nearer to victory threshold but race still too close to call
  114. US election 2020 live results: Donald Trump faces Joe Biden in tight presidential race
  115. Joe Biden bullish but down-ballot races deliver disappointment for Democrats
  116. International observers say US elections 'tarnished' by Trump and uncertainty
  117. Thursday briefing: Joe Biden with one hand on the prize
  118. Police warn public to expect tougher crackdown on Covid lockdown breaches
  119. Live Coronavirus live news: England begins lockdown as Russia, Poland, Austria, Switzerland see record case rises
  120. Trump threatens to sue his way to victory amid millions of uncounted votes
  121. Rocky Horror's Richard O'Brien: ‘I should be dead. I've had an excessive lifestyle'
  122. 'Count every vote': protesters take to streets across US as ballots tallied

H4 Headings

42 :
  1. Live results Follow the US election results in full
  2. Full report Biden says he's on course to win as Trump threatens to fight outcome
  3. Paths to victory What Trump and Biden need to win
  4. Business Global stock markets climb on prospect of Biden presidency
  5. Live results Follow the US election results in full
  6. Full report Biden says he's on course to win as Trump threatens to fight outcome
  7. Paths to victory What Trump and Biden need to win
  8. Business Global stock markets climb on prospect of Biden presidency
  9. Global view Observers say US elections 'tarnished' by Trump and uncertainty
  10. Global view Observers say US elections 'tarnished' by Trump and uncertainty
  11. Trump President threatens to sue amid uncounted votes
  12. Trump President threatens to sue amid uncounted votes
  13. Election fight A divided US takes to the streets as the count goes on
  14. Election fight A divided US takes to the streets as the count goes on
  15. Coronavirus England enters second lockdown
  16. Domestic violence Fears for those facing abuse as England enters second lockdown
  17. EHRC Inquiry launched into BAME inequalities in health and social care
  18. Coronavirus England enters second lockdown
  19. Domestic violence Fears for those facing abuse as England enters second lockdown
  20. EHRC Inquiry launched into BAME inequalities in health and social care
  21. Business live Bank of England boosts QE by £150bn and predicts lockdown downturn
  22. Business live Bank of England boosts QE by £150bn and predicts lockdown downturn
  23. Face covering Anger as England secondary schools given last-minute rules
  24. Randox Tory-linked firm involved in testing failure given new £347m Covid contract
  25. Environment Tiny air pollution rise linked to 11% more Covid-19 deaths – study
  26. Face covering Anger as England secondary schools given last-minute rules
  27. Randox Tory-linked firm involved in testing failure given new £347m Covid contract
  28. Environment Tiny air pollution rise linked to 11% more Covid-19 deaths – study
  29. Jobs Chancellor expected to extend furlough beyond December
  30. Jobs Chancellor expected to extend furlough beyond December
  31. Basaksehir 2-1 Man Utd Ba punishes dismal United defending
  32. Chelsea 3-0 Rennes Blues cruise but Havertz tests positive
  33. Champions League Leipzig sink nine-man PSG, Sevilla win thriller
  34. Basaksehir 2-1 Man Utd Ba punishes dismal United defending
  35. Chelsea 3-0 Rennes Blues cruise but Havertz tests positive
  36. Champions League Leipzig sink nine-man PSG, Sevilla win thriller
  37. Football Weekly Champions League latest and flying Foxes
  38. Football Weekly Champions League latest and flying Foxes
  39. Find every story All the latest pieces as they are launched
  40. Find every story All the latest pieces as they are launched
  41. The Recap Sign up and get our email of editors' picks
  42. The Recap Sign up and get our email of editors' picks

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

101 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-78705427-1

Links - Internal

18:

Links - Internal (nofollow)

0:

Links - Outbound

377:

Links - Outbound (nofollow)

4:

Keyword Cloud for Guardian.co.uk

minwidthexcessive lifestyledefensiveminwidth8125em lettersnuggetchina bansunderfcitemfcitemisdynamiccard fctrailcountcommentcountfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9b 0625remtransparentfcitempillarartsfcitemtypecommentfcitemisdynamiccardfcitemisboostedformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2livecoronavirus footballmarginleftfctodayheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2maxwidth 4624emfccontainerstorypackagewarnnobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar rwhymetributevaccineseefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf4625emfccontainerstorypackagefcitemclassfcitempillarfcitemtypecommentlpanel imggsubsthrasher flexfontfacefontfamilyguardianamericasfcitemisdynamiccardswitzerlandfcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3 fcitemfooterhorizontalheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffpolice warn publicformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiandead iveformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffminwidth8125emcovid secondformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardianfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinkschildformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttftif4eobjecttypeof tttesmodulereturn tvarelections tarnished0 3125rem 125remformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headlinefcitemliveblogblocktextafterboxshadow3125rem 0 3125remautomediaheadlineguardian egyptianfcitemfcitemisdynamiccard ufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remfcitemfcitemisdynamiccard fctrailcountcommentcount inlineiconlapsesstreetslettersformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headlinenhs woefully shortheadlineformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardiandead ive hadschool14pxrpanelroadformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoffformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardianlockdown russiawidth 140pxeducation society scienceereturnfcsublink4titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoffheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2weekformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttffcitemfcitemtypecommentfcitemhascutoutformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttftext sans webhelveticaformattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2140pxflex rpanelfacebookformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headlinegalleryfcitemresultfcitemfooterhorizontal fcsublinksfccontainerstorypackagereallylettersbuttonacrosstrumplandprotesters takemargin 0uk politicsinstanceoffootballfcitemliveupdatesfcitemstandardtabletuncounted votesclaimssociety science techclosefcitemisdynamiccardfcitemhasfloatingsublinksfcitemfcitemisdynamiccardfctrailcountfctrailcountcommentcountsectionfccontainerinvestigationpaletteneuehelveticaariallucidafullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2sans webhelvetica neuehelveticaariallucidachampionsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardianvotesviewfcitemtitlebackgroundimagenonefccontainerstorypackageclosureminwidth375emgvcoronaoverviewcountrytech global developmentsurgeformattruetypefontweight500fontstylenormalfontfacefontfamilyguardiangooglefcitemhasfloatingsublinksfcitemisdynamiccard fcsublinklearntext egyptianfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoffsofcitemliveupdates ufauxblocklinkhoverfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttfworkufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remleavelongformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttffullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2covidrocky horrorsformattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headlinephotoformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardianfcitemfcitemliveoeifrereturnfindfcitemisdynamiccardfcitemthreequarterstabletfcitemhassublinks2whilefirst timefcitemliveblogblocktextafterboxshadow3125remmetheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradienttoaustria switzerlandselfisolatethursdaytitlepieceguardian headline fullguardianukthreshold butsymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof tttesmodulereturntravellers comingskillfcitemtitlequotedtakeelectionformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlineufauxblocklinkhoverheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoffunderfundingformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwofftarnished by trumpcreative skill duringbecause of coronavirusformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttffcitemfcitemisdynamiccardfcitemlivecontactheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoffsigntdefaultfunctionreturnlifestylenonfunctionevar teeesmodulefunctionreturnlockdown breachesfunctionnvar rfunctionfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttftreiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeofbansflexwayvotewebguardian headlinechinafunctionnvarfcitemcontentabovepadding0375remcouldapphas beenformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoffbegins lockdownfontfacefontfamilyguardian headlinecountnovemberrecapformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardianfcitempillarlifestylefcitemtypecommentfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffsansculturenuggetbuttonschampions leagueget our3fcitempillarsportfcitemisdynamiccardfearsteeesmodulefunctionreturn edefaultfunctionreturn ereturnfcitemhasfloatingsublinksfcitemisdynamiccardclassfcitemhassublinksbeatnadalintobriefing joewantbottom808a9b808a9b 0625remtransparentfcitemstandfirstwrappernotbut race stillmarketstttesmodulereturn tvaremailtext sansrichard obriencallreaders on lessonscontent2fcitem fctrailcountcommentcountfullguardianfcitemfcitemisdynamiccardclassfcitempillarfcitemtypecommentfcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4relativetttesmodulereturnhorrors richardlettersnugget culturenuggetbuttonsglobal development obituarieslight0media maxwidthtrump really settlesweetformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwofflettersnugget h1videorfunction oeifrereturn reexportsvarminwidth6125em lettersnuggetformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardiannbspv last weekanalysiselectoralsymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnegyptianminwidth8125embodynothasactivepageskintreiel1exportsreturncoronavirusbackgroundcolorfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2h1historicbecausemarginbottomwe knowhad to selfisolateformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardianfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardianfcitem fcitemmediameta inlineiconplayrussia polandcityelementinteractivecontentmaincolumninteractivehandglobalflex lpanelfcitemfcitemtypecommentnotfcitempillarspecialreportbiden nearerfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks ufauxblocklinkhoverdisplaylockdown russia polandfuturebackvictoryeventsus elections 2020race stillenters secondsee recordtheremedia allgroupseyes eyetebindnullrreturn nonfunctionevarenvironment ukfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2medianonchinese travellers comingfcsublinksdisplaynonemedia minwidth 4625emfccontainerstorypackageelection 2020edition switchminwidth6125emgsubsthrasherposition relativeengland begins lockdownwebhelvetica neuehelveticaariallucidatrump and uncertaintylevelitsuk politics educationfaceguardianexpect tougher crackdownagainstformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttfavailablearoundformattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2plansnonfunctionevarformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardianworthmyshouldstreets across usliketheyformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardianguardian readersalleged10pxmediatodnrfunctionereturn tebindnullrreturnthreshold but racebecomeinlineplayshortgivendevelopment obituariesfcsublinklinksectionfccontainereventaltpaletteformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2every votelineheightlearnedfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2still toodigitalsite4625emfccontainerstorypackage fcitemisdynamiccardfcitemhasfloatingsublinksimggsubsthrasher flexformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianfirstsocialplay videoswitzerland seeextratougherfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2allformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttfus election resultoverflowformattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headlinescienceduring the firstformattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headlinevoidformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2warn publictechpictureminwidth6125emgsubsthrasher flexwaveglobal developmentfcitemfooterhorizontalfccontainerstorypackagefcitem youtubemediaatomplaybuttonfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4youtubemediaatomplaybutton inlineplaynfunctionformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianbusiness coronaviruscarehaduncountedimggsubsthrashercount every vote08125remfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttfformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwofffailedguardian labsfcitemfooterhorizontalresultsfcitem fcsublinktitlefcitemisdynamiccardfcitemthreequarterstabletfcitemhassublinks2 fcitemfooterhorizontal fcsublinkfccontainerstorypackagefcitemfcitemisdynamiccard ufauxblocklinkhoverpatronstoo closefcitemisdynamiccardfcitemthreequarterstalltablet fcitemcontentbelowfccontainerstorypackagefcsublinksfccontainerstorypackageusengland enters secondtitlepieceguardian headlinenobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvarvote protesters takefcitemfooterhorizontal fcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3all and minwidth6125emfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9b6125emfccontainerstorypackagedevelopment6pxprintformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianfcitemliveupdatesfcitemfullmedia75tabletformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2americanfccontainerheadertitlespanfccontainerstorypackage fccontainerheadertitlenonfunctionevar teeesmodulefunctionreturn edefaultfunctionreturnpolitics education societyso farfcitempillarspecialreportfcitemtypecommentfcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4 fcitemfooterhorizontalstoryheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwofffullstill too closefcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradienttoexcessiveufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125rem 0dontnowformattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2formattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headlinetitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffenvironment6formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttfoverflow hiddenaustriaelementatomcontentmaincolumninteractive elementinteractivecontentmaincolumninteractivetextdemocracyfcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3football environment uk1fcitempillarartsfcitemisdynamiccardformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttfsans webhelveticafctrailcountfctrailcountcommentcountsectionfccontainerbreakingpalettefcitemmediametatodnrfunctionereturntif4eobjecttypeof tttesmodulereturnformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardianwoefullyclimate crisisfcitem youtubemediaatomplaybutton inlineplayformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian2pxformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoffelectionsreally settlemorepaddingtopbottom808a9b808a9bformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttfhorrors richard obrientrumpstalliedwebguardian5headline fullguardian egyptiantarnishedpubliccount everyfcitemfcitemisdynamiccardfcitemliveupdates ufauxblocklinkhoversecond lockdowntitlepieceguardianeditorshealthnonchineseculturenuggetimagesportsweexpect tougherpicturesformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiansectionletterstreatfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3 fcitemfooterhorizontal fcsublinkfccontainerstorypackagetravellersputyour childfcitempillaropinionfcitemtypecommentformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2lettersnugget lettersbuttonheadlineguardian egyptian webguardiandefensive lapsesdoformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffhelpfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttflinearfccontainerstorypackagetrump threatenspaidaround the worldopinionfcitempillarnewsfcitemtypecommentyearsstudyminwidth 7125emfccontainerstorypackagefctrailcountcommentcount inlineicon125remrfunction oeifrereturnrockyfindsheadlineguardianpresidentresult in courtfcitem fctrailcountcommentcount inlineiconfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttflinefcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125remonlycould trump reallysetpositivecaseeducation societycovid lockdown breachesbreachesnearer to victoryraceformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttfarchiveenters7125emfccontainerstorypackagefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttfout of 5weeklytif4eobjecttypeofrichardreviewcoronavirus football environmentreexportsvar treiel1exportsreturnswitchsearch jobsprotect peopleaustria switzerland seeformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttffcitemisdynamiccardfcitemhasfloatingsublinksfcitemtypelivefcitempillarnewsdeathtransparent transparentafterformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headlinecreativeheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoffrunitedbriefingcreative skillviewedodtattoofunctionetreturnnew york cityrace still tooformattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttffcitemtypeliveemergencyweeklychangegvcoronaoverviewnewshave beenhiddenformattruetypefontweight300fontstylenormalfontfacefontfamilyguardianfcitemisdynamiccardfcitemthreequarterstalltablet fcitemcontentbelowfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia100tabletsettle uslaunchedfcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125rem 0formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttfamongfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2most viewedegyptian webgeorgiaseriffontweightnormalfccontainerstorypackagesay us electionsoeifrereturn reexportsvar treiel1exportsreturnfunctionnvar rfunction oeifrereturnyoufcitemiscommentablenotfcitemtypecomment fcitemmetaminwidthcalc4chradiovictory thresholdgo backmostonefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoffmaytvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvarstatesnbspv lasttitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttffontsizesubscribefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwofflettersnuggetacross usballotsinlineicon150bnfcitem fcitemmediametaobrien i shouldformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttffullguardian headlineguardianinquirypolice warn0625remtransparent 0625remtransparentsecuredropiosfcitemmetaminwidthcalc4chobserversfctrailcountfctrailcountcommentcountsectionfccontainerlongrunningpalettebusinessflex lpanel imggsubsthrasherwoefully shortnecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeoffcitemfcitemisdynamiccardfcitempillarnewsthemtforvarelection resultfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2fcitemfcitemisdynamiccard fcitemtitlequotedenvironment uk politicsscience tech globalskill duringheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2wildlifefcitemtypelive fcsublinkcoronavirus englandsvglinearfccontainerstorypackage fcitemliveupdatesheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttffcitempillarspecialreportfcitemisdynamiccardformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianpolitics educationswimmingfcitemisdynamiccardfcitemthreequarterstalltabletus election 20200courtformattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff25pxfcitem fcsublinkformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headlinesixwonformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttftech globaltoofullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2fccontainerheadertitlespanfccontainerstorypackagetopbegins lockdown russiaheightsecond wavepresidential electionfccontainerinnerbordertop1px solidformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headlinelive resultsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoffamplettersnugget maxwidthsportblock10pxstreets acrossupminwidth30emgvcoronaoverviewbriefing joe bidenalleged fraudfcitempillarlifestylefcitemisdynamiccardwinfcitemcontentbelowpadding0fccontainerstorypackageeyesformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headlinecomingcovid surgeleave nhs woefullyfcitemcontentabovepadding0375rem 0mediaswitzerland see recordfcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypeliveuk editionformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardianfcsublinkfccontainerstorypackagesomereadcase risesnearerformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardianvjsbigplaybuttonelection nightclimatefcitemfcitemisdynamiccardfcitemliveupdatesfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3 fcitemfooterhorizontalheadline fullguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoffnecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnobrientebindnullrreturn nonfunctionevar teeesmodulefunctionreturnhad an excessivewon becausepermanent closurebank of england0ssolskjrheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2england entersfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoffprotectpoliticsfcitemmediameta inlineicondoesfcsublink fcsublinklinksectionfccontainereventaltpalettetdefaultfunctionreturn treturnclose to callsociety sciencehearttake to streetsegyptian webguardian headlineeducationformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardiansavefcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4 fcitemfooterhorizontalformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardianscience techpoland austriadisplay blocktimessaysriskmaxwidthminwidth 4625emfccontainerstorypackagerussia poland austriasign upengland beginsfctrailcountfctrailcountcommentcountsectionfccontainersombrepalettehorrors3125rem 125remfcitemfooterhorizontal fcsublinkfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks40mediahospitalfcitemstandfirstwrapper fcitemmetabackgroundimagenonefccontainerstorypackagemountcallstrump reallyfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2stoplive coronavirusfccontainerheadertitleformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoffleave nhsreally settle usformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttfformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardianformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttfemptyifedefaultfunctionreturnall and minwidth8125emformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianshould be deadsymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeoffcsublinkkickerdisplayblockwidth100fccontainerstorypackagelockdown0 3125remdespitebestjetpackformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2short for covidstillprize4624emfccontainerstorypackagenumbersexpectr in todnrfunctionereturnviewed mostdeathspositionstrictvartforvar rlabsjoeformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headlinesueivefullguardian headlineguardian egyptianyork cityrfunctioncovid19homecould trumpforcesbottom808a9b808a9b 0625remtransparent 0625remtransparentfcitemisdynamiccardfcitemthreequarterstabletfcitemhassublinks2 fcitemfooterhorizontalfcitemfcitemisdynamiccardfcitemtypecommentnotfcitempillarspecialreportfcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelive fcsublinkformattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2toryformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2fcitemmetabackgroundimagenonefccontainerstorypackagewebgeorgiaseriffontweightnormalfccontainerstorypackagereexportsvar treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeofnobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeofscenesdemocracy in trumpland12pxfcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9btreturnunderfunding leaverecordcall usfcitempillaropinionfcitemisdynamiccardartfcitemisdynamiccardfcitemfullmedia100tabletformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttfbeginsformattruetypefontweight700fontstylenormalfontfacefontfamilyguardianstarsthreatens to sueformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headlineone handguardiansheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoffsettle us electionheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff1s linearfccontainerstorypackageheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2nonchinese travellerssay usoffrocky horrors richardsaysoliddemocratsfcsublinktitleknow sobiden with onefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttfdonald trumptreatfcitemliveupdatesfcitemfullmedia100tabletbans nonchinesevote protestersenters second lockdownfootball environment5 starsworldsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2observers sayfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks fcsublinktebindnullrreturngetpermanentegyptian webguardianminwidth7125embodynothasactivepageskinfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwofffraudsee record casenhs woefullylike to hear1steeesmodulefunctionreturn edefaultfunctionreturnereturn odtattoofunctionetreturnlessonsheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoffheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2changeformattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttfyourbecause i saynew yorkpmreadersfcitem ufauxblocklinkhoverenglandedefaultfunctionreturn ereturn odtattoofunctionetreturnelections 2020covid second waveinternationalus electionformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttfformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headlinefcitemliveblogblocktextafterboxshadow3125rem 0record case risescrackdown on covidfacingformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headlineformattruetypefontweight400fontstylenormalfontfacefontfamilyguardiantheirtrappedknow so farfcitemtypecommentformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoffus electionsfctrailcountcommentcountcrisisformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardianprotesterslong readminwidth 4625emfccontainerstorypackage fcitemisdynamiccardfcitemhasfloatingsublinksculturehopehaveoeifrereturn reexportsvarlast weekformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headlinedeadpeople0625remtransparentobituariesuncertaintyformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headlinelpanelformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttffcitempillarsportfcitemtypecommentthreatelementatomcontentmaincolumninteractivegvelexsnaptrumpsecondfcitemlivelettersnugget culturenuggetimagemantougher crackdownrussiadividedrecord casesettleminwidth6125emfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttfnewtackletodnrfunctionereturn tebindnullrreturn nonfunctionevarfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoffmarginbutfullguardian egyptianfunctionreturntinysocietyfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2ballots talliedbusiness coronavirus footballminwidth 6125emfccontainerstorypackage3125remrisesoverformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headlinetransparentcoming from ukchina bans nonchineseobservers say usmargintopformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardianfcitemcontentabovepadding0375rem 0media maxwidthourhear from youlatestlettersnugget culturenuggetarrowpolandwe know soyears of underfundingbasaksehirwouldjoe bidenpoliceduringheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwofftreiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnpowerhisfcitempillarnewsfcitemisdynamiccardeditioncovid lockdowntttesmodulereturn tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeofhearnecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeofheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2fcitemliveupdatesformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttfheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headlinethreatensnbspvamidbut raceformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf0media maxwidth 4624emfccontainerstorypackagefcitem vjsbigplaybuttonagainformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlinelastfcitempillarnewsfarformattruetypefontweight900fontstylenormalfontfacefontfamilyguardianimggsubsthrasher flex rpanelloveheadline fullguardian headlineguardiancanstarformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffnhsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardianformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttfburstteeesmodulefunctionreturnyoutubemediaatomplaybuttonedefaultfunctionreturn ereturnpodcastfcitemliveupdatesfcitemthreequarterstalltabletbans nonchinese travellerstwitterlessons of lockdownus elections tarnishedcutheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwofftimeunderfunding leave nhsfightnightformattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headlineformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardianheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoffminwidth6125emgvcoronaoverviewpodcasts1s linearfccontainerstorypackage fcitemliveupdatesfcitemfooterhorizontal fcsublinkfccontainerstorypackageleft1bntvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeofheeverywebhelveticaformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2eyefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoffenglandsnonefccontainerinnerbordertop1pxcenturiesfactsvictory threshold butformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2englands lockdownwidthpartuk schoolyorkleaguesearchhelp savehasparisfcitemisdynamiccardfcitemfullmedia100tablet fcitemfooterhorizontalfccontainerstorypackageformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttffcsublinksdisplaynonemedia minwidthreexportsvartreatscontainerusepresidentialpfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2gocrackdowndonaldfootball weeklyjonathanfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttffullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoffsupportlpanel imggsubsthrasherbidenblackmost viewed mostfcsublinksdisplaynonemediafullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttfformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlinecoronavirus england beginslinkedcostcoronavirus livetellformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardiannight in newthresholdbeenshopwereformattruetypefontweight600fontstylenormalfontfacefontfamilyguardianriseevery vote protestersviewed most viewedneedpoland austria switzerlandfcitemcontentbelowfccontainerstorypackage fcitemisdynamiccardfcitemfullmedia100tablettrumpland i wonformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttffcitemhasfloatingsublinksfcitemisdynamiccardfcitemiscommentablenotfcitemtypecommentheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwofflondonoutculturenuggetarrowfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoffheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2bankknowsay soive hadjobstvartakesfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwofffcsublink fcsublinklinksectionfccontainereventpalettefcitemcontentbelowfccontainerstorypackagefcsublinklinksectionfccontainereventpalettecasesus as ballotsworldfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff

Longtail Keyword Density for Guardian.co.uk

KeywordsOccurences
fc-itemliveblog-blocktextafterbox-shadow-3125rem 0 3125rem26
0 3125rem -125rem26
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem 013
sans webhelvetica neuehelveticaariallucida13
text sans webhelvetica13
0media max-width 4624emfc-container--story-package12
fc-itemcontent--abovepadding0375rem 0media max-width12
fc-item fc-itemmedia-meta inline-icon12
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff9
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf9
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline7
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem6
bottom808a9b808a9b 0625remtransparent 0625remtransparent6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b 0625remtransparent6
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
out of 56
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem 06
us elections 20206
us as ballots5
england begins lockdown5
take to streets5
know so far5
we know so5
fullguardian headlineguardian egyptian5
headline fullguardian headlineguardian5
titlepieceguardian headline fullguardian5
record case rises5
see record case5
russia poland austria5
poland austria switzerland5
streets across us5
austria switzerland see5
switzerland see record5
font-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff25
tarnished by trump4
every vote protesters4
count every vote4
threatens to sue4
covid second wave4
trump and uncertainty4
all and min-width8125em4
us elections tarnished4
vote protesters take4
observers say us4
min-width 4625emfc-container--story-package fc-item--is-dynamic-cardfc-item--has-floating-sublinks4
fc-item--is-dynamic-cardfc-item--three-quarters-tall-tablet fc-itemcontent--belowfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-100-tablet4
still too close4
race still too4
say us elections4
fc-item--is-dynamic-cardfc-item--three-quarters-tabletfc-item--has-sublinks-2 fc-itemfooter--horizontal fc-sublinkfc-container--story-package4
fc-sublinksdisplaynonemedia min-width 4625emfc-container--story-package4
threshold but race4
fc-itemfooter--horizontal fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-34
police warn public4
expect tougher crackdown4
crackdown on covid4
covid lockdown breaches4
england enters second4
enters second lockdown4
biden with one4
bank of england4
fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-3 fc-itemfooter--horizontal4
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-3 fc-itemfooter--horizontal fc-sublinkfc-container--story-package4
fc-itemfooter--horizontal fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-44
fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-4 fc-itemfooter--horizontal4
but race still4
close to call4
victory threshold but4
flex l-panel imgg-subs-thrasher4
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline4
nearer to victory4
because of coronavirus4
should be dead4
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount inline-icon4
dead ive had4
had an excessive4
l-panel imgg-subs-thrasher flex4
1s linearfc-container--story-package fc-item--live-updates4
headline fullguardian egyptian4
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian4
us election 20204
imgg-subs-thrasher flex r-panel4
readers on lessons3
around the world3
underfunding leave nhs3
lessons of lockdown3
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf3
obrien i should3
horrors richard obrien3
years of underfunding3
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff3
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff23
hear from you3
leave nhs woefully3
night in new3
coming from uk3
all and min-width6125em3
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff23
nbspv last week3
rocky horrors richard3
new york city3
non-chinese travellers coming3
like to hear3
bans non-chinese travellers3
china bans non-chinese3
had to self-isolate3
short for covid3
nhs woefully short3
during the first3
creative skill during3
most viewed most3
business coronavirus football3
lockdown russia poland3
fc-item youtube-media-atomplay-button inline-play3
tif4eobjecttypeof tttesmodulereturn tvar3
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof tttesmodulereturn3
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof3
treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn3
reexportsvar treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof3
oeifrereturn reexportsvar treiel1exportsreturn3
rfunction oeifrereturn reexportsvar3
functionnvar rfunction oeifrereturn3
fc-item fc-trailcount--commentcount inline-icon3
tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar3
global development obituaries3
tech global development3
science tech global3
society science tech3
education society science3
politics education society3
uk politics education3
environment uk politics3
football environment uk3
tttesmodulereturn tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof3
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar r3
begins lockdown russia3
really settle us3
coronavirus england begins3
briefing joe biden3
because i say3
trumpland i won3
democracy in trumpland3
result in court3
us election result3
settle us election3
trump really settle3
r in todnrfunctionereturn3
could trump really3
egyptian webguardian headline3
headlineguardian egyptian webguardian3
coronavirus football environment3
edefaultfunctionreturn ereturn odtattoofunctionetreturn3
teeesmodulefunctionreturn edefaultfunctionreturn ereturn3
nonfunctionevar teeesmodulefunctionreturn edefaultfunctionreturn3
tebindnullrreturn nonfunctionevar teeesmodulefunctionreturn3
todnrfunctionereturn tebindnullrreturn nonfunctionevar3
viewed most viewed3
fc-itemliveblog-blocktextafterbox-shadow-3125rem 026
0 3125rem26
3125rem -125rem26
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover24
transparent transparent23
fc-item u-faux-block-link--hover18
fc-item fc-itemmedia-meta18
min-width 4625emfc-container--story-package18
max-width 4624emfc-container--story-package16
us election16
text sans13
sans webhelvetica13
webhelvetica neuehelveticaariallucida13
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem13
joe biden13
fc-containerinnerborder-top1px solid12
0media max-width12
fc-itemmedia-meta inline-icon12
fc-itemcontent--abovepadding0375rem 0media12
fc-itemstandfirst-wrapper fc-itemmetabackground-imagenonefc-container--story-package12
headlineguardian egyptian11
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline11
media all11
us elections10
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf10
fc-item--has-floating-sublinksfc-item--is-dynamic-card fc-sublink10
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff29
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff9
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf9
headline fullguardian9
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount8
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks fc-sublink8
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
min-width 6125emfc-container--story-package8
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff28
fc-itemfooter--horizontal fc-sublinkfc-container--story-package8
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline7
0625remtransparent 0625remtransparent7
fc-trailcount--commentcount inline-icon7
fc-item--is-commentablenotfc-item--type-comment fc-itemmetamin-widthcalc4ch6
fc-item fc-sublinktitle6
5 stars6
play video6
fc-item fc-sublink6
fc-item fc-trailcount--commentcount6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
fc-itemfc-item--is-dynamic-cardfc-item--live-updates u-faux-block-link--hover6
bottom808a9b808a9b 0625remtransparent6
fc-item--type-live fc-sublink6
fc-item vjs-big-play-button6
fc-item--live-updates u-faux-block-link--hover6
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks u-faux-block-link--hover6
titlepieceguardian headline6
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem6
donald trump6
fc-item--is-dynamic-cardfc-item--three-quarters-tabletfc-item--has-sublinks-2 fc-itemfooter--horizontal6
elections 20206
edition switch6
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-4 fc-itemfooter--horizontal6
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-3 fc-itemfooter--horizontal6
election night6
so far5
protesters take5
streets across5
fullguardian headlineguardian5
election 20205
across us5
text egyptian5
new york5
climate crisis5
ballots tallied5
egyptian webguardian5
guardian labs5
we know5
know so5
case rises5
font-facefont-familyguardian headline5
second lockdown5
coronavirus england5
england enters5
england begins5
begins lockdown5
russia poland5
poland austria5
austria switzerland5
switzerland see5
record case5
see record5
have been5
fullguardian egyptian4
expect tougher4
sign up4
letters-nugget letters-button4
most viewed4
lockdown breaches4
covid lockdown4
tougher crackdown4
vote protesters4
enters second4
every vote4
count every4
uncounted votes4
elections tarnished4
say us4
observers say4
margin 04
champions league4
one hand4
eyes eye4
flex l-panel4
second wave4
covid second4
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian4
dead ive4
police warn4
covid surge4
l-panel imgg-subs-thrasher4
help save4
imgg-subs-thrasher flex4
flex r-panel4
letters-nugget culture-nuggetimage4
ive had4
excessive lifestyle4
go back4
warn public4
letters-nugget max-width4
search jobs4
fc-containerheadertitlespanfc-container--story-package fc-containerheadertitle4
uk edition4
min-width 7125emfc-container--story-package4
1s linearfc-container--story-package4
fc-itemfc-item--is-dynamic-card fc-itemtitle--quoted4
linearfc-container--story-package fc-item--live-updates4
trump threatens4
egyptian webgeorgiaseriffont-weightnormalfc-container--story-package4
fc-item--is-dynamic-cardfc-item--three-quarters-tall-tablet fc-itemcontent--belowfc-container--story-package4
fc-itemcontent--belowfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-100-tablet4
4625emfc-container--story-package fc-item--is-dynamic-cardfc-item--has-floating-sublinks4
fc-sublinksdisplaynonemedia min-width4
fc-itemfooter--horizontal fc-sublinksfc-container--story-package4
fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-34
fc-item--is-dynamic-cardfc-item--full-media-100-tablet fc-itemfooter--horizontalfc-container--story-package4
fc-sublinkfc-container--story-package fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-44
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live fc-sublink4
too close4
still too4
live results4
functionnvar rfunction4
tttesmodulereturn tvar4
race still4
but race4
threshold but4
victory threshold4
biden nearer4
fc-sublink fc-sublinklinksectionfc-container--event-palette3
get our3
defensive lapses3
football weekly3
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff23
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff3
fc-sublink fc-sublinklinksectionfc-container--event-alt-palette3
rfunction oeifrereturn3
letters-nugget culture-nuggetarrow3
letters-nugget culture-nuggetbuttons3
overflow hidden3
min-width6125em letters-nugget3
position relative3
fc-item youtube-media-atomplay-button3
width 140px3
display block3
min-width8125em letters-nugget3
youtube-media-atomplay-button inline-play3
call us3
alleged fraud3
football environment3
business coronavirus3
protect people3
york city3
uk school3
your child3
skill during3
creative skill3
permanent closure3
coronavirus football3
environment uk3
development obituaries3
uk politics3
has been3
oeifrereturn reexportsvar3
politics education3
education society3
society science3
science tech3
tech global3
min-width6125emg-subs-thrasher flex3
global development3
letters-nugget h13
element-atomcontentmain-column--interactive element-interactivecontentmain-column--interactive3
reexportsvar treiel1exportsreturn3
briefing joe3
tebindnullrreturn nonfunctionevar3
nonfunctionevar teeesmodulefunctionreturn3
teeesmodulefunctionreturn edefaultfunctionreturn3
edefaultfunctionreturn ereturn3
ereturn odtattoofunctionetreturn3
lockdown russia3
live coronavirus3
coronavirus live3
say so3
englands lockdown3
won because3
webguardian headline3
presidential election3
tdefaultfunctionreturn treturn3
election result3
settle us3
really settle3
trump really3
could trump3
todnrfunctionereturn tebindnullrreturn3
guardian readers3
treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof3
tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof3
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn3
long read3
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof3
tif4eobjecttypeof tttesmodulereturn3
richard obrien3
horrors richard3
rocky horrors3
last week3
nbspv last3
travellers coming3
first time3
non-chinese travellers3
bans non-chinese3
china bans3
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar3
tforvar r3
woefully short3
nhs woefully3
leave nhs3
underfunding leave3
viewed most3
fc-item119
fc-itemfc-item--is-dynamic-card116
headline101
u-faux-block-link--hover75
us49
transparent46
solid41
lockdown39
all38
036
fc-item--live-updates36
fc-sublink34
min-width32
trump31
egyptian30
letters-nugget30
guardian30
election29
new27
-125rem26
3125rem26
uk26
fc-itemliveblog-blocktextafterbox-shadow-3125rem26
biden25
fc-itemmetabackground-imagenonefc-container--story-package24
fc-itemfc-item--is-dynamic-cardfc-item--live-updates24
fc-item--has-floating-sublinksfc-item--is-dynamic-card22
covid22
but21
england20
max-width20
more19
coronavirus19
inline-icon19
live18
fc-itemmedia-meta18
fc-itemfooter--horizontal18
fc-itemfc-item--live18
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks18
4625emfc-container--story-package18
text18
strictvar17
fc-item--is-dynamic-card17
out16
fc-containerheadertitle16
116
4624emfc-container--story-package16
fc-sublinksfc-container--story-package16
fc-itemtitle--quoted16
you16
fc-item--is-dynamic-cardfc-item--has-floating-sublinks16
we15
flex15
fc-trailcount--commentcount14
0625remtransparent14
has14
help13
results13
joe13
neuehelveticaariallucida13
victory13
webhelvetica13
not13
sans13
best13
media13
width13
over13
fc-item--is-dynamic-cardfc-item--three-quarters-tall-tablet12
fc-item--is-dynamic-cardfc-item--three-quarters-tabletfc-item--has-sublinks-212
fc-item--has-floating-sublinksfc-item--is-dynamic-cardclassfc-item--has-sublinks12
my12
fc-containerinnerborder-top1px12
fc-item--is-dynamic-cardfc-item--full-media-100-tablet12
fc-itemstandfirst-wrapper12
fc-item--live-updatesfc-item--full-media-100-tablet12
edition12
fc-sublinkkickerdisplayblockwidth100fc-container--story-package12
fc-itemcontent--abovepadding0375rem12
fc-item--live-updatesfc-item--three-quarters-tall-tablet12
our12
fc-itemfc-item--is-dynamic-cardfc-item--live12
football12
0media12
first12
fc-itemcontent--belowpadding0fc-container--story-package12
votes12
have12
second11
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian11
amp11
headlineguardian11
years11
people11
after10
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live10
play10
news10
world10
eyes10
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf10
say10
210
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff10
fc-itemtitlebackground-imagenonefc-container--story-package10
take10
elections10
his10
get10
says9
win9
race9
streets9
had9
police9
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff9
country9
lifestyle9
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff29
save9
fullguardian9
been9
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf9
jobs8
climate8
6125emfc-container--story-package8
global8
business8
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff28
review8
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-48
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-38
fc-itemfooter--horizontalfc-container--story-package8
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
fc-sublinkfc-container--story-package8
treturn8
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
count8
record8
because8
video8
vote8
latest8
opinion8
court8
why8
night8
your8
so8
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
37
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
height7
stars7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
go7
gallery7
city7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
art7
10pxmedia7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
sport7
min-width6125emg-subs-thrasher7
switch7
search7
subscribe7
crisis7
during7
home7
paid7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
they7
void7
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
call7
47
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
fight7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
across7
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
fc-itemclassfc-item--pillar-fc-item--type-comment7
public7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
one7
up7
line7
bank7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
content6
titlepieceguardian6
see6
cut6
margin-bottom6
font-size6
letters-button6
culture-nuggetimage6
off6
dead6
coming6
time6
covid-196
rise6
face6
begins6
full6
death6
tougher6
email6
could6
may6
know6
threatens6
close6
too6
work6
donald6
states6
every6
uncertainty6
fc-today6
vjs-big-play-button6
fc-item--live6
fc-item--type-live6
fc-item--is-dynamic-cardfc-item--is-boosted6
fc-item--is-commentablenotfc-item--type-comment6
environment6
1s6
politics6
sign6
fc-itemfc-item--is-dynamic-cardfc-item--type-commentnotfc-item--pillar-special-report6
fc-itemfc-item--is-dynamic-cardclassfc-item--pillar-fc-item--type-comment6
fc-itemfc-item--is-dynamic-cardfc-item--pillar-news6
digital6
fc-item--type-comment6
science6
weekly6
fc-itemmetamin-widthcalc4ch6
fc-itemfc-item--type-commentnotfc-item--pillar-special-report6
readers6
fc-sublinktitle6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
back6
bottom808a9b808a9b6
like5
austria5
ballots5
tallied5
switzerland5
democracy5
black5
poland5
russia5
protesters5
amid5
case5
use5
do5
rises5
london5
leave5
deaths5
study5
last5
wave5
linked5
paris5
background-color5
enters5
pictures5
nhs5
bans5
into5
podcasts5
inquiry5
league5
font-facefont-familyguardian5
position5
york5
calls5
line-height5
far5
most5
6px5
culture5
presidential5
way5
labs5
svg5
webguardian5
still5
protect5
stop4
worth4
pm4
analysis4
now4
their4
tackle4
2px4
them4
surge4
against4
margin-top4
around4
given4
hear4
cost4
sweet4
trapped4
me4
support4
tiny4
international4
among4
r-panel4
imgg-subs-thrasher4
fc-itemfc-item--type-commentfc-item--has-cutout4
10px4
facebook4
l-panel4
twitter4
weekly-changegv-corona-overview4
1bn4
power4
podcast4
love4
none4
health4
margin-left4
min-width8125em4
radio4
only4
display4
were4
top4
dont4
american4
padding-top4
view4
overflow4
margin4
its4
tell4
despite4
ive4
cases4
week4
54
man4
tribute4
richard4
eye4
should4
education4
basaksehir4
min-width7125embodynothas-active-pageskin4
claims4
excessive4
read4
under4
archive4
champions4
events4
some4
min-width375emgv-corona-overview4
viewed4
fc-sublinklinksectionfc-container--event-alt-palette4
rfunction4
fc-item--live-updatesfc-item--full-media-75-tablet4
threshold4
functionnvar4
part4
webgeorgiaseriffont-weightnormalfc-container--story-package4
warn4
fc-sublinklinksectionfc-container--event-palette4
0s4
expect4
fc-itemcontent--belowfc-container--story-package4
fc-item--is-dynamic-cardfc-item--has-floating-sublinksfc-item--type-livefc-item--pillar-news4
crackdown4
fc-sublinksdisplaynonemedia4
fc-item--pillar-lifestylefc-item--type-comment4
fc-item--pillar-lifestylefc-item--is-dynamic-card4
08125rem4
takes4
breaches4
markets4
observers4
r4
tarnished4
tory4
tforvar4
tvar4
ereturn4
result4
linearfc-container--story-package4
need4
sue4
uncounted4
tttesmodulereturn4
7125emfc-container--story-package4
fc-containerheadertitlespanfc-container--story-package4
fc-item--live-updatesfc-item--standard-tablet4
fc-item--pillar-artsfc-item--type-comment4
nearer4
if4
launched4
150bn4
prize4
fc-item--pillar-special-reportfc-item--is-dynamic-card4
hand4
fc-item--pillar-special-reportfc-item--type-comment4
gv-elex-snap4
fc-item--pillar-newsfc-item--type-comment4
beat4
fc-item--pillar-opinionfc-item--is-dynamic-card4
fc-item--pillar-opinionfc-item--type-comment4
fc-item--pillar-newsfc-item--is-dynamic-card4
fc-item--pillar-sportfc-item--is-dynamic-card4
englands4
facing4
fc-item--pillar-sportfc-item--type-comment4
fc-item--pillar-artsfc-item--is-dynamic-card4
positive3
nonfunctionevar3
would3
united3
self-isolate3
lapses3
nadal3
child3
times3
editors3
skill3
contact3
school3
solskjr3
defensive3
photo3
scenes3
wildlife3
culture-nuggetarrow3
recap3
p3
society3
block3
culture-nuggetbuttons3
closure3
empty3
edefaultfunctionreturn3
level3
picture3
teeesmodulefunctionreturn3
creative3
become3
permanent3
finds3
available3
does3
emergency3
worlds3
nfunction3
tdefaultfunctionreturn3
americas3
functionreturn3
light3
instanceof3
burst3
14px3
jonathan3
learn3
extra3
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff23
failed3
heart3
met3
plans3
put3
trumps3
fraud3
electoral3
six3
securedropios3
thursday3
swimming3
min-width8125embodynothas-active-pageskin3
odtattoofunctionetreturn3
alleged3
facts3
min-width6125em3
hospital3
element-atomcontentmain-column--interactive3
element-interactivecontentmain-column--interactive3
fears3
november3
min-width6125emgv-corona-overview3
min-width30emgv-corona-overview3
app3
nbspv3
fc-trailcountfc-trailcount--commentcountsectionfc-container--sombre-palette3
63
non-chinese3
fc-trailcountfc-trailcount--commentcountsectionfc-container--investigation-palette3
numbers3
patrons3
shop3
jetpack3
future3
fc-trailcountfc-trailcount--commentcountsectionfc-container--breaking-palette3
rocky3
horrors3
travellers3
social3
print3
fc-trailcountfc-trailcount--commentcountsectionfc-container--long-running-palette3
fc-item--pillar-news3
forces3
inline-play3
set3
youtube-media-atomplay-button3
change3
risk3
guardians3
lessons3
learned3
china3
centuries3
site3
mount3
again3
briefing3
underfunding3
care3
woefully3
short3
obrien3
hope3
he3
really3
treat3
sports3
automedia3
letters3
settle3
5px3
h13
sectionletters-treat3
obituaries3
hidden3
threat3
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof3
relative3
12px3
left3
development3
tech3
todnrfunctionereturn3
140px3
tebindnullrreturn3
president3
tif4eobjecttypeof3
long3
story3
democrats3
star3
oeifrereturn3
there3
can3
google3
road3
won3
trumpland3
want3
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn3
divided3
historic3
while3
groups3
reexportsvar3
vaccine3
treiel1exportsreturn3
find3
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof3
treatscontainer3

Who hosts Guardian.co.uk?

Guardian.co.uk Hosting Provider Information

Hosted IP Address:151.101.129.111
Hosted Hostname:151.101.129.111
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
Consortium GARR
0.1258%

HTTP Header Analysis for Guardian.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 205825
Content-Encoding: gzip
Content-Type: text/html; charset=utf-8
ETag: W/"hash-8144877930205813983"
Link:; rel=preload; as=style; nopush,; rel=preload; as=script; nopush,; rel=preload; as=script; nopush,; rel=preload; as=script; nopush
Accept-Ranges: bytes
Date: Thu, 05 Nov 2020 09:10:11 GMT
Age: 62
X-Timer: S1604567412.638321,VS0,VE1
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Content-Security-Policy: default-src https:; script-src https: 'unsafe-inline' 'unsafe-eval' blob: 'unsafe-inline'; frame-src https: data:; style-src https: 'unsafe-inline'; img-src https: data: blob:; media-src https: data: blob:; font-src https: data:; connect-src https: wss:; child-src https: blob:; object-src 'none'; base-uri 'none'
Referrer-Policy: no-referrer-when-downgrade
Feature-Policy: camera 'none'; microphone 'none'; midi 'none'; geolocation 'none'
X-GU-Edition: uk
Cache-Control: max-age=60, stale-while-revalidate=6, stale-if-error=864000, private, no-transform
Vary: Accept-Encoding,User-Agent

Guardian.co.uk Domain Nameserver Information

HostIP AddressCountry
dns1.p02.nsone.net 198.51.44.2
dns2.p02.nsone.net 198.51.45.2
dns3.p02.nsone.net 198.51.44.66
dns4.p02.nsone.net 198.51.45.66
ns01.theguardiandns.com 45.54.51.1
ns02.theguardiandns.com 45.54.51.65
ns03.theguardiandns.com 45.54.51.129
ns04.theguardiandns.com 45.54.51.193


Need to find out who hosts Guardian.co.uk?


Domain Registration (WhoIs) information for Guardian.co.uk

 Domain name:
guardian.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 30-Oct-2015

Registrar:
GoDaddy.com, LLC. [Tag = GODADDY]
URL: http://uk.godaddy.com

Relevant dates:
Registered on: before Aug-1996
Expiry date: 16-Jun-2022
Last updated: 31-Oct-2019

Registration status:
Registered until expiry date.

Name servers:
dns1.p02.nsone.net
dns2.p02.nsone.net
dns3.p02.nsone.net
dns4.p02.nsone.net
ns01.theguardiandns.com
ns02.theguardiandns.com
ns03.theguardiandns.com
ns04.theguardiandns.com

WHOIS lookup made at 09:09:59 10-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Guard-academy.com
Guard Academy
Guard-advice.work
guard-advice.work – このドメインはお名前.comで取得されています。
Guard-archaeology.co.uk
GUARD Archaeology Limited
Guard-beauty.site
Guard-Beauty
Guard-bird.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify

Recently Updated Websites

Grimsbycab.org.uk (1 second ago.)Bytebot.net (1 second ago.)Preferredlease-complaint.org (2 seconds ago.)Sjdzl.com (2 seconds ago.)Canvs.in (2 seconds ago.)Dornelasmodaintima.com.br (4 seconds ago.)Commitwinreign.com (5 seconds ago.)Homezone.co.uk (7 seconds ago.)Huntil.top (7 seconds ago.)Elcocinillaerrante.com (7 seconds ago.)Duvallphoto.com (7 seconds ago.)Ascensorestvc.com (7 seconds ago.)Tingxiangshuixie.com (8 seconds ago.)Hat.hu (10 seconds ago.)Couldna.com (10 seconds ago.)Biya.life (11 seconds ago.)Jeden-ersten-sonntag.com (11 seconds ago.)Andreahedquist.com (14 seconds ago.)Skepticrats.com (14 seconds ago.)Alsouza.com (15 seconds ago.)Veganboro.com (16 seconds ago.)Khehra.law (17 seconds ago.)Ansiroth.com (17 seconds ago.)Ama-agency.com (17 seconds ago.)Razinarchitects.com (18 seconds ago.)Drjaw.mobi (19 seconds ago.)Bymovil.es (20 seconds ago.)Humanitarianselfcare.com (20 seconds ago.)Aceofficemavens.com (21 seconds ago.)Ingframex.com (21 seconds ago.)

Recently Searched Keywords

postmessagetoplayerplayer method (1 second ago.)6座、8座转马 6 (2 seconds ago.)large teams (3 seconds ago.)assignment help hong kong (4 seconds ago.)lowenovaawards (5 seconds ago.)集合 (6 seconds ago.)2 explorers that were sponsored by england (7 seconds ago.)metric system (9 seconds ago.)islas baleares (9 seconds ago.)var winw (10 seconds ago.)reservasnotcias do (10 seconds ago.)szybko schudnij z brzucha (11 seconds ago.)vu du (13 seconds ago.)notcias (14 seconds ago.)grand theft auto: vice city (14 seconds ago.)thecfsb (15 seconds ago.)ancascochatrek 5d4n duracin (16 seconds ago.)compassionate eating (16 seconds ago.)15$ (17 seconds ago.)lifetraffic (17 seconds ago.)雷火竞技app下载博在哪里 (17 seconds ago.)formformid (18 seconds ago.)defermdi (18 seconds ago.)couple sex (19 seconds ago.)зил (20 seconds ago.)аренда хостинга (20 seconds ago.)do poder (21 seconds ago.)ssl certificateincludedddos protection160gbpsfull (21 seconds ago.)fiewin.com (23 seconds ago.)towar (24 seconds ago.)