Gwendolina.net Favicon Gwendolina.net

Gwendolina.net Website Thumbnail
Checking...
MEMBERS ONLY LOG IN — Secure
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
gwendolina
Domain extension
net
Domain registered:
2016-03-07
Domain updated:
2020-03-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is gwendolina.net ranked relative to other sites:

Percentage of visits to gwendolina.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Gwendolina.net registered?
A: Gwendolina.net was registered 4 years, 7 months, 1 week, 6 days, 3 hours, 2 minutes, 52 seconds ago on Monday, March 7, 2016.
Q: When was the WHOIS for Gwendolina.net last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 2 days, 3 hours, 2 minutes, 52 seconds ago on Wednesday, March 4, 2020.
Q: What are Gwendolina.net's nameservers?
A: DNS for Gwendolina.net is provided by the following nameservers:
  • ns15.domaincontrol.com
  • ns16.domaincontrol.com
Q: Who is the registrar for the Gwendolina.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Gwendolina.net?
A: Gwendolina.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Gwendolina.net each day?
A: Gwendolina.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Gwendolina.net resolve to?
A: Gwendolina.net resolves to the IPv4 address 198.185.159.144.
Q: In what country are Gwendolina.net servers located in?
A: Gwendolina.net has servers located in the United States.
Q: What webserver software does Gwendolina.net use?
A: Gwendolina.net is powered by Squarespace webserver.
Q: Who hosts Gwendolina.net?
A: Gwendolina.net is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Gwendolina.net worth?
A: Gwendolina.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Gwendolina.net?

Gwendolina.net Hosting Provider Information

Hosted IP Address:198.185.159.144
Hosted Hostname:198.185.159.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Gwendolina.net

Http-Version: 1.1
Status-Code: 401
Status: 401 Unauthorized
date: Tue, 29 Sep 2020 01:01:53 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
Age: 0
Transfer-Encoding: chunked
x-contextid: ZvJfwn3K/885UChJr
server: Squarespace

Gwendolina.net Domain Nameserver Information

HostIP AddressCountry
ns15.domaincontrol.com 97.74.107.8
ns16.domaincontrol.com 173.201.75.8


Need to find out who hosts Gwendolina.net?


WhoIs information for Gwendolina.net

 Domain Name: gwendolina.net
Registry Domain ID: 2010002102_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-03-04T18:47:50Z
Creation Date: 2016-03-07T16:13:59Z
Registrar Registration Expiration Date: 2021-03-07T16:13:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: Login to show email
Server: NS15.DOMAINCONTROL.COM
Name Server: NS16.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-09-29T01:00:00Z

Gwendolina.net Free SEO Report

Website Inpage Analysis for Gwendolina.net

H1 Headings

2 :
  1. welcome
  2. exclusive VIP Members Area

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Gwendolina.net

vinehovervideoiconstyleborderuseiconfill4183c4sqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialicons2s easeinotransitionopacity 2suseiconfillff0031sqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen170ms easeinoutotransitionbackgroundcolorsocialiconsstylesolid dataslicetypesocialiconshover iconwrapper2s easeinmoztransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonstracks trackul li asqsslidewrapperdataslidetypelockscreendatacompoundtypepopupoverlayactionbandsintowneaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreen2s easeinmstransitionopacitydataslicetypesocialicons linkedinimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainernotautoimagebackgroundcolordataslicetypesocialiconshover twitterhoverdataslicetypebuttons lisqsslidewrapperdataslidetypelockscreensqsmodallightboxdataslicetypesocialiconshover vinehoverdataslicetypesocialiconshover tidalp asqsslidewrapperdataslidetypelockscreenusemaskfill222sqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregulardataslicetypesocialicons googleplayformitemsqsslidewrapperdataslidetypelockscreen1linkedindataslicetypesocialicons stitcherdataslicetypebuttons uluseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinoutdataslicetypesocialiconshover meetupimportantsqsslidewrapperdataslidetypelockscreen2s easeintransitionopacitydataslicetypesocialiconshover mediumhoverscreen and maxwidth600pxsqsslidewrapperdataslidetypelockscreen170ms easeinoutmoztransitionbackgroundcolor 170msvevohoverdataslicetypesocialiconshover vimeoall and maxwidth1020pxsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons emailulstackeduldataslicetypesocialicons youtubeuseiconfille6b91esqsslidewrapperdataslidetypelockscreendataslicetypesocialicons facebookdataslicetypesocialicons githubrsshoverdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypelockscreenyoutubehoversocialiconssizesmallsocialiconsstyleborderdataslicetypesocialiconshover rsshoverdataslicetypesocialiconshover foursquarehoverasqsslidewrapperdataslidetypelockscreen dataslicetypetwittersqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineddropboxsqsslicecustomform asqsslidewrapperdataslidetypelockscreenpasswordstylerectangle dataslicetypepasswordhouzzhoverbandsintownhoverdataslicetypemap gmnoprint0px 0pxbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover redditsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactiondataslicetypesocialicons tumblr2s easeinotransitionopacityformwrapper inputtypesubmithoversqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactioneaseinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover mediumresponsivewrappernotstackedsocialiconsstyleborder dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutsqsslidewrapperdataslidetypelockscreen dataslicetypebuttonssqsmodallightboxcontent lightboxinner lightboxcontentscreenalldataslicetypesocialicons twitchsqsmodallightboxcontentdataslicetypesocialiconshover tumblrhoverdataslicetypemapmediumuseiconfillfffsqsslidewrapperdataslidetypelockscreen0 0sqsslidewrapperdataslidetypelockscreeniconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypelockscreendataslicetypetwitternotdatacompoundtypedataslicetypealbumhover iconwrappersvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolordataslicetypetwittersocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialicons fivehundredpixgoodreadstidaleaseinoutmstransitionbackgroundcolor2s 2ssocialiconscolorstandardsocialiconsstyleborderuseiconfill84bd00sqsslidewrapperdataslidetypelockscreensqsslicealbumplaylist tracksdataslicetypesocialicons goodreadssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactionuseiconfill006ed2sqsslidewrapperdataslidetypelockscreensquarespacemeetuphoversqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover instagramdataslicetypesocialiconshover linkedinhoverdataslicetypesocialicons codependataslicetypesocialicons tidallightboxcontent formwrapper psocialiconssizesmallsocialiconsstyleknockoutahoversqsslidewrapperdataslidetypelockscreensocialiconssizemediumsocialiconsstyleregulardataslicetypesocialiconshover vevohoveruseiconfill5adfcbsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover smugmughoverdataslicetypebuttons ulstackedeaseinmstransitionopacity 2s2s170ms easeinoutsqsslidewrapperdataslidetypelockscreenstumbleupontwittertwitchsocialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons soundcloudsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinedataslicetypesocialicons bandsintowndribbbleuseiconfill00b4b3sqsslidewrapperdataslidetypelockscreenuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversqsalbumminimal dataslicetypealbum sqsslicealbumplaylisticonwrappericonwrapperwidth24pxheight24pxmargin0dataslicetypesocialiconshover facebookhoverstitcher170ms easeinoutotransitionbackgroundcolor 170mssocialiconssizelargesocialiconsstyleknockoutrdiohoverdataslicetypebodydataslicetypecountdown countdowncontentdataformatnumericvineaudioplayericonsstyleborder dataslicetypealbumdataslicetypesocialicons meetup2em 0px 0pxdataslicetypesocialiconshover pinteresthoversoliddataslicetypesocialiconshover squarespacehovereaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorgalleryvideobackgroundmobiledataslicetypesocialiconshover vscodataslicetypesocialiconshover smugmugformitemsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslicealbumplaylistdemoalbumeaseinmoztransitionopacity 2ssvgsocialwebkittransitionbackgroundcolor 170mssocialstackedtextalignleft dataslicetypesocialiconsdataslicetypesocialiconshover codepensocialiconssizeextrasmallsocialiconsstylesolidactionsstackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidarrowiconsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactiononly screenformwrapper pusebackgroundfillfffsqsslidewrapperdataslidetypelockscreeninstagramhoverulsqsslidewrapperdataslidetypelockscreensocialiconssizelargesocialiconsstylesolidmediumhover8pxshowtracktitledataslicetypenavigation ul lidataslicetypesocialiconshover behancesocialstacked dataslicetypesocialiconscountdownunitdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockouteaseinmoztransitionopacitybordercolorsqsslicealbumplaylist tracks trackuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialiconshover iconwrapperlightboxinner lightboxcontent formwrapperdataslicetypecountdown countdowncontentdataformattextualpdataslicetypesocialiconshover spotifyhoverdataslicetypegallery galleryvideobackgroundmobilesqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideindataslicetypesocialicons rdiosqssliceplaybuttoniconwrapperhoversoundcloudhoverbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveraudioplayericonsstylesolideaseoutopacityaudioplayericonsstyleregularbuttonstyleraiseddataslicetypenavigationdisclaimercontainersqsslidewrapperdataslidetypelockscreendataslicetypealbumhoverdataslicetypesocialiconshover vscohovereaseinotransitionopacitydataslicetypesocialiconshover yelphoversocialiconsstylesolid dataslicetypesocialiconshoverli ahoversqsslidewrapperdataslidetypelockscreencountdowncontentdataformattextual countdownunituseiconfill7ac143sqsslidewrapperdataslidetypelockscreenresponsivewrapperstacked dataslicetypenavigationdataslicetypesocialiconshover bandsintowndataslicetypebuttonssqsmodallightboxopenvimeohoverfoursquarehoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesolidiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreenbuttonstylesoliddataslicetypelockgmnoprintlockstyleborder dataslicetypelockgoogleplayhoverdataslicetypesocialiconshover githubuseiconfill00ab6csqsslidewrapperdataslidetypelockscreenbuttonshapepillaudioplayericonsstylebordersocialstackeduseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen6pxuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreenuseiconfilleb4924sqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderinputtypetextsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons vinedataslicetypesocialiconshover snapchathoverapplepodcasthoversqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangleactionsstacked inputwrappernothiddenuseiconfillc41200sqsslidewrapperdataslidetypelockscreentracksocialiconssizeextralargesocialiconsstyleknockoutspotifyhoverusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconspinterestmapstyleminimaldarkdataslicetypesocialicons pinterestuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautoimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinegithubdataslicetypealbum sqsslicealbumplaylistplayingfoursquaredataslicetypecountdownsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedsmugmugasqsslidewrapperdataslidetypelockscreen buttonstyleoutlinedataslicetypesocialiconshovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockout170ms easeinoutmstransitionbackgroundcoloreaseinotransitionopacity 2sdataslicetypegalleryeaseinouttransitionbackgroundcolorbuttontypesubmitsqsslidewrapperdataslidetypelockscreeniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesoliduseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidlockstyleregular dataslicetypelockiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutgooglehoverresponsivewrapperstackeddataslicetypesocialicons instagramdataslicetypesocialiconshover emailhoverusemaskfillfffsqsslidewrapperdataslidetypelockscreen170ms easeinouttransitionbackgroundcolor 170mssocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreensocialiconssizemediumsocialiconsstyleknockoutbehancehovereasesqsslidewrapperdataslidetypelockscreendataslicetypebuttonssqsslidewrapperdataslidetypelockscreenmaxwidth600pxsqsslidewrapperdataslidetypelockscreen2em 0pxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypebuttons ul lisvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypetwitternotdatacompoundtype tweettimestampdataslicetypesocialiconshover googleplaydataslicetypebody pcaptchacontainerwrapperdataslicetypesocialiconshover meetuphoverusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoversocialiconssizeextralargesocialiconsstylesoliddataslicetypesocialiconshover flickrhover14pxbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineeaseinoutmoztransitioncolordataslicetypesocialiconshover thedotssqsslidesqsslideanimationreadydropboxhoverpasswordstyleunderlinedsocialiconsstyleregulardataslicetypesocialicons behanceerrormessagesqsslidewrapperdataslidetypelockscreensqsslicecustomform ahoversqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineyoutubebuttonplaypauseresponsivewrapperstacked sqsslicecustomformformwrapperapplepodcastfacebookhoverdataslicetypesocialiconshover dribbbledataslicetypesocialiconshover goodreadshoverdataslicetypesocialiconshover dropboxhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenbuttonstyleoutline dataslicetypebuttonsdataslicetypesocialiconshover snapchatuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill3b5998sqsslidewrapperdataslidetypelockscreenitunesdataslicetypealbumdataslicetypesocialicons mediumuseiconfillea4c89sqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover imdbhoverlightboxinner lightboxcontentsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline0sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons imdbdataslicetypesocialiconshover applepodcasthoverdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreengithubhoverresponsivewrapperstackedtextaligncenter7pxformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlinedribbblehoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperdataslicetypesocialicons snapchatfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emsocialiconssizemediumsocialiconsstyleborderlinkedinhoversqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcentericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliduseiconfill382110sqsslidewrapperdataslidetypelockscreengoogleplayeaseinoutotransitionbackgroundcoloreaseinoutmoztransitionbackgroundcolor 170msusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutinputtypepasswordsqsslidewrapperdataslidetypelockscreen10pxiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconsdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolid1pxdataslicetypetwitternotdatacompoundtype tweetbodyimdbhoveractionsnotstackedhouzzdataslicetypesocialiconshover googleplayhoverlightboxcontentsocialiconsstylesolidsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidsqsslicecustomformdataslicetypesocialiconshover houzzsqsmodallightboxcontent lightboxinnersnapchathoverfacebookdataslicetypesocialiconshover thedotshoverdataslicetypesocialiconshover stitcher0pxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialicons stumbleuponusebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreendatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover stumbleuponhoversocialiconsstyleborderuseiconfill0976b4sqsslidewrapperdataslidetypelockscreenuseiconfill1769ffsqsslidewrapperdataslidetypelockscreenpasswordstylerectangleshowtracktitle sqsalbumminimal dataslicetypealbumformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypealbum sqsslicealbumplaylistdataslicetypealbum tracktitlesqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayaction2s easeintransitionopacity 2sdataslicetypebodysqsslidewrapperdataslidetypelockscreeneaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypesocialiconshover twitchhovertweetbodydataslicetypesocialiconshover vimeohoverbehancesqsslicealbumplaylistuseiconfilltransparentsqsslidewrapperdataslidetypelockscreenactionssqsslidewrapperdataslidetypelockscreenaudioplayericonsstylesolid dataslicetypealbumhovertracksredditall and maxwidth600pxsqsslidewrapperdataslidetypelockscreensqsslidewrapperdataslidetypelockscreen dataslicetypecountdown countdowncontentdataformatnumericonlydataslicetypebuttons ul lisqsslidewrapperdataslidetypelockscreenbuttonshaperoundedcornersdataslicetypesocialiconshover spotifydataslicetypebuttons li asqsslidewrapperdataslidetypelockscreendataslicetypegallery galleryvideobackgrounddataslicetypeheadingnotdatacompoundtypetrackprogressbareaseoutopacity 170msdataslicetypesocialicons itunesdataslicetypesocialicons dropboxdataslicetypecountdown countdowncontentdataformattextual countdownunitvscodataslicetypesocialiconshover imdbsocialiconssizesmallsocialiconsstyleregulardataslicetypesocialiconshover rdiocodepenlightboxcontent formwrapperdataslicetypesocialicons rssspansqsslidewrapperdataslidetypelockscreenyelptumblrvideoiconstyleregularuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsrdiodataslicetypesocialiconshover squarespacedataslicetypealbumhover iconwrapperhoveruseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout2emdataslicetypesocialiconshover linkedincountdowncontentdataformattextualsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover googlehoveruseiconfille52d27sqsslidewrapperdataslidetypelockscreenpasswordstyleunderlined dataslicetypepasswordcodepenhoverautoflex1iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutsocialiconssizelargesocialiconsstylebordersqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperuseiconfille0393esqsslidewrapperdataslidetypelockscreen0ms 0msdataslicetypealbum iconwrapperusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidemailhoverasqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappersocialiconsstylesolid dataslicetypesocialiconsdataslicetypegallerysqsgallerygridsquarespacehoversnapchatsqsslidecontainerdataslidetypepopupoverlaystumbleuponhoverinputwrapperdataslicetypebuttons li ahoversqsslidewrapperdataslidetypelockscreentweetavatardataslicetypesocialiconshover youtubehoverdataslicetypepassword arrowicon170ms easeinouttransitionbackgroundcolorresponsivewrapperstacked dataslicetypebuttons uldataslicetypesocialicons vevodataslicetypesocialiconshover bandsintownhoverdataslicetypesocialiconshover twitch2s easesqsslidewrapperdataslidetypelockscreenvevovideoiconstyleknockouticonwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreensqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconslockstyleknockout dataslicetypelockeaseintransitionopacity 2sbordercolor 170msdatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreen01sdataslicetypesocialiconshover iconwrapperhoveruseiconfill35465dsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons googledataslicetypesocialicons spotifyuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutshowtracktitle sqsalbumminimal4pxiconwrapperlastchildsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover fivehundredpixhoverdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypelockscreenthedotssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautodataslicetypesocialiconshover dropboxvideoiconstylesoliddataslicetypealbum trackprogressbardataslicetypesocialiconshover youtubeyelphoverdataslicetypealbum iconwrappersqsslidewrapperdataslidetypelockscreen2s easeinmstransitionopacity 2s2s easeinmoztransitionopacitysvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversocialiconssizeextrasmallsocialiconsstyleborderlockstylesolidul liuseiconfill1ab7easqsslidewrapperdataslidetypelockscreenresponsivewrapperinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlinesocialiconssizesmallsocialiconsstylesolidthedotshoversqsalbumminimal dataslicetypealbumsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsmeetupinputtypesubmitsqsslidewrapperdataslidetypelockscreen100msaudioplayericonsstyleregular dataslicetypealbum170ms easeoutopacity 170msdataslicetypebodysqsslidewrapperdataslidetypelockscreen dataslicetypebodysqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonstumblrhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedli asqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesolidiconwrapperhoverdataslicetypenavigation ulsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialiconshover foursquaresqsslicealbumplaylistplayingdataslicetypesocialiconshover instagramhoverinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackediconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolid170ms easeinoutmoztransitionbackgroundcolorsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover yelpbuttonstyleoutlinesqsmodallightbox formwrapperdataslicetypesocialiconshover googlelidataslicetypesocialiconshover fivehundredpixdataslicetypesocialicons twitterinstagramuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolideaseinout bordercolor 170msinputtypesubmithoversqsslidewrapperdataslidetypelockscreenbordercolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreentweettimestampdataslicetypesocialiconshover goodreadsuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolorsvgsocialwebkittransitionbackgroundcoloreaseinoutmstransitionbackgroundcolor 170msdataslicetypebuttons ulsqsslidewrapperdataslidetypelockscreencountdowncontentdataformatnumeric5pxeaseinoutsqsslidewrapperdataslidetypelockscreen socialiconsstylesoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutlockstylesolid dataslicetypelockfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxdataslicetypemap gmstyleccuseiconfill6441a5sqsslidewrapperdataslidetypelockscreenbuttonstyleoutlinesqsmodallightboxautosqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstyleknockoutsqsalbumminimalsocialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover stitcherhover5emfont14pxtidalhoverdataslicetypesocialiconshover itunesdataslicetypesocialiconshover behancehoverdataslicetypesocialiconshover soundcloudhovereaseinmstransitionopacityuseiconfill7dbb00sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons foursquareusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialicons dribbble170ms easeinoutmstransitionbackgroundcolor 170msuseiconfilldc4e41sqsslidewrapperdataslidetypelockscreentracktitledataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesoliduseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularsqsslicecustomformsqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstylesolidtweetdisplaynameuseiconfill222sqsslidewrapperdataslidetypelockscreenusemaskfilltransparentsqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovereaseinout bordercoloruseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularbuttonstyleoutlinesqsslidecontainernotautoimagebackgroundcoloruseiconfill00b488sqsslidewrapperdataslidetypelockscreendataslicetypebuttons litwitterhoverdataslicetypesocialiconshover tidalhoversqssliceplaybuttoniconwrapperspotifysocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypesocialiconshover stumbleuponuseiconfill0099e5sqsslidewrapperdataslidetypelockscreensocialiconssizeextralargesocialiconsstyleborder0useiconfill1ea9e1sqsslidewrapperdataslidetypelockscreen1sdataslicetypesocialiconshover pinterestuseiconfill55aceesqsslidewrapperdataslidetypelockscreendataslicetypebuttons asqsslidewrapperdataslidetypelockscreen3pxdataslicetypesocialiconshover facebookiconwrapperwidth36pxheight36pxmargin0lockstyleknockoutdataslicetypesocialiconshover rdiohoverituneshoveruseiconfill0063dcsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledreddithoveruseiconfille4405fsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover houzzhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddensocialiconsstyleknockoutdataslicetypesocialicons houzzfivehundredpixiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutlockstylebordersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody prsssocialiconssizeextrasmallsocialiconsstyleregulardataslicetypesocialiconshover applepodcastsocialiconssizeextralargesocialiconsstyleregulardataslicetypealbum sqsslicealbumplayliststackedstitcherhoverdataslicetypesocialicons redditiconwrappersqsslidewrapperdataslidetypelockscreenemailadisplayblocksqsslidewrapperdataslidetypelockscreeniconwrapperwidth32pxheight32pxmargin0iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesolideaseintransitionopacitybuttonsqsslidewrapperdataslidetypelockscreenuseiconfillf60sqsslidewrapperdataslidetypelockscreenul lisqsslidewrapperdataslidetypelockscreenp ahoversqsslidewrapperdataslidetypelockscreenvimeosqsslidewrapperdataslidetypelockscreen responsivewrappernotstackedsvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons applepodcastinputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreen170ms easeoutopacityeaseinouttransitioncolordataslicetypesocialicons yelp0mseaseinoutmoztransitionbackgroundcolordataslicetypesocialicons smugmugdataslicetypesocialicons squarespacesqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedfffsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover emailsqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinetweethandlesocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialicons vimeoavisitedsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover githubhoversqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypelockscreengooglelockstyleregularresponsivewrapperstacked dataslicetypenavigation ulusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutsocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen170ms easeinoutsqsslicecustomform spansqsslidewrapperdataslidetypelockscreenfivehundredpixhoverpinteresthoverdataslicetypesocialiconshover twitterdataslicetypealbum sqsslicealbumplaylistdemoalbumimdbresponsivewrapperstacked dataslicetypebuttonsgalleryvideobackgrounddataslicetypepassword170ms easeinout bordercolorsqsslidelayercontentuseiconfill8c8070sqsslidewrapperdataslidetypelockscreendataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypelockscreensocialstackedtextalignleftdataslicetypebuttons ahoversqsslidewrapperdataslidetypelockscreenusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialicons vscodataslicetypesocialiconshover tumblruseiconfillf94877sqsslidewrapperdataslidetypelockscreenlightboxinneruseiconfill000sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover soundclouduseiconfill007ee5sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonsactionsnotstacked inputwrappernothiddenbuttonstyleoutline sqsslicecustomformgmstyleccdataslicetypesocialiconshover dribbblehoverdataslicetypealbum sqsslicealbumplaylist trackssocialiconssizelargesocialiconsstyleregulardataslicetypesocialiconshover vinesqsslidewrapperdataslidetypelockscreen dataslicetypecountdownflickrhovereaseinoutotransitioncolorsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lidataslicetypesocialiconshover flickrdataslicetypesocialiconshover reddithoveraudioplayericonsstyleknockoutdataslicetypesocialiconshover rssdataslicetypesocialiconshover ituneshovereaseinoutotransitionbackgroundcolor 170msflickriconwrapperwidth28pxheight28pxmargin0datacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypelockscreenvscohoverinputwrappernothiddenuseiconfillff4500sqsslidewrapperdataslidetypelockscreensqsslicealbumplayliststackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconstwitchhoverdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypelockscreen170mseaseinoutmstransitioncolorbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreensoundcloudgoodreadshoversvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vevomaxwidth1020pxsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons flickrdataslicetypesocialicons thedotssmugmughoveruseiconfillec4652sqsslidewrapperdataslidetypelockscreeniconwrapperborder2pxdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutactionsstacked inputwrapperdataslicetypesocialiconshover codepenhoverdisplaytablesqsslidewrapperdataslidetypelockscreendataslicetypetwitter tweetavataruseiconfillae995asqsslidewrapperdataslidetypelockscreenuseiconfillcc2127sqsslidewrapperdataslidetypelockscreenlisqsslidewrapperdataslidetypelockscreenasqsslidewrapperdataslidetypelockscreen buttonstyleoutline sqsslicecustomform

Longtail Keyword Density for Gwendolina.net

KeywordsOccurences
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
2em 0px 0px6
data-slice-typenavigation ul li5
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typelock-screen5
170ms ease-outopacity 170ms5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
lightbox-content form-wrapper p4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typelock-screen4
all and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen4
data-slice-typebuttons ul li4
responsive-wrapperstacked data-slice-typenavigation ul4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline data-compound-typepopup-overlay-action3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
all and max-width1020pxsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
responsive-wrapperstacked data-slice-typebuttons ul3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typelock-screen3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
border-color 170ms15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen13
data-slice-typebuttons ul12
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typelock-screen11
data-slice-typebuttons li10
password-style-underlined data-slice-typepassword10
data-slice-typenavigation ul10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
ul li9
password-style-rectangle data-slice-typepassword9
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typelock-screen8
li asqs-slide-wrapperdata-slide-typelock-screen8
170ms ease-in-out-moz-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typelock-screen7
social-icons-style-border data-slice-typesocial-icons7
show-track-title sqs-album-minimal7
tracks track7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
button-style-outline sqs-slice-custom-form6
2em 0px6
button-style-outline data-slice-typebuttons6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typelock-screen6
0px 0px6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
data-slice-typesocial-iconshover icon-wrapperhover6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typealbum track-progress-bar6
data-slice-typesocial-icons dribbble5
responsive-wrapperstacked data-slice-typenavigation5
ease-outopacity 170ms5
ul lisqs-slide-wrapperdata-slide-typelock-screen5
data-slice-typesocial-icons dropbox5
170ms ease-outopacity5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons instagram5
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons codepen5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons github5
data-slice-typesocial-icons google5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons email5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons youtube5
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typebuttons5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons rdio5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons linkedin5
0ms 0ms5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons vevo5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons bandsintown5
2s 2s5
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover squarespace4
form-wrapper p4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover rdio4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typelock-screen4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typelock-screen4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
li ahoversqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout data-slice-typelock3
social-icons-style-knockout data-slice-typesocial-icons3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
social-icons-style-solid data-slice-typesocial-icons3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typelock-screen3
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
lock-style-solid data-slice-typelock3
actionsstacked input-wrapper3
form-itemsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typelock-screen3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slide-wrapperdata-slide-typelock-screen responsive-wrappernotstacked3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
asqs-slide-wrapperdata-slide-typelock-screen data-slice-typetwitter3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown3
data-slice-typebodysqs-slide-wrapperdata-slide-typelock-screen data-slice-typebody3
p ahoversqs-slide-wrapperdata-slide-typelock-screen3
p asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen142
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay52
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen44
2s41
asqs-slide-wrapperdata-slide-typelock-screen38
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typelock-screen34
data-slice-typegallery33
data-slice-typelock30
data-slice-typepassword29
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
form-wrapper28
sqs-album-minimal27
1s25
0sqs-slide-wrapperdata-slide-typelock-screen24
sqs-slice-custom-form24
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen24
sqs-modal-lightbox-content24
icon-wrapper23
ul22
lightbox-inner22
responsive-wrapperstacked21
socialstacked20
socialstackedtext-align-left20
020
li20
sqs-slide-wrapperdata-slide-typelock-screen20
data-slice-typebody19
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
data-slice-typenavigation17
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen17
sqs-slice-album-playlist17
tracks16
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
border-color15
gallery-video-background14
ahoversqs-slide-wrapperdata-slide-typelock-screen13
p13
sqs-modal-lightbox-open13
0px12
social-icons-style-solid12
icon-wrapperhover12
actionsnotstacked12
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen12
password-style-rectangle11
password-style-underlined11
data-slice-typetwitter11
countdown-contentdata-formattextual11
actionsstacked11
all11
0ms10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
solid10
squarespace10
110
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
lisqs-slide-wrapperdata-slide-typelock-screen10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typetwitternotdata-compound-type10
google9
reddit9
codepen9
rss9
behance9
smugmug9
bandsintown9
snapchat9
applepodcast9
soundcloud9
spotify9
stumbleupon9
thedots9
tidal9
tumblr9
twitch9
dribbble9
rdio9
vevo9
foursquare9
houzz9
googleplay9
imdb9
goodreads9
instagram9
github9
itunes9
linkedin9
dropbox9
flickr9
medium9
fivehundredpix9
meetup9
facebook9
email9
pinterest9
twitter9
stitcher9
ease-in-out-ms-transitionbackground-color9
max-width600pxsqs-slide-wrapperdata-slide-typelock-screen9
yelp9
vsco9
youtube9
vine9
vimeo9
ease-in-outtransitionbackground-color9
ease-in-out-moz-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
data-slice-typealbumhover8
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen7
button-style-outlinesqs-modal-lightbox7
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen7
social-icons-style-border7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typelock-screen7
input-wrappernothidden7
spansqs-slide-wrapperdata-slide-typelock-screen7
data-slice-typemap7
video-icon-style-border7
show-track-title7
track7
sqs-slice-play-buttonicon-wrapperhover6
audio-player-icons-style-border6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
audio-player-icons-style-solid6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
ulsqs-slide-wrapperdata-slide-typelock-screen6
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
track-progress-bar6
10px6
button-style-raised6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
input-wrapper6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
2em6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
social-icons-style-regular6
ituneshover5
social-icons-style-knockout5
linkedinhover5
vinehover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen5
tumblrhover5
twitchhover5
instagramhover5
ease-outopacity5
vimeohover5
mediumhover5
twitterhover5
100ms5
imdbhover5
buttonsqs-slide-wrapperdata-slide-typelock-screen5
houzzhover5
vevohover5
tidalhover5
meetuphover5
thedotshover5
snapchathover5
01s5
rsshover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
reddithover5
smugmughover5
lock-style-regular5
sqs-slide-layer-content5
yelphover5
stumbleuponhover5
soundcloudhover5
spotifyhover5
rdiohover5
squarespacehover5
pinteresthover5
stitcherhover5
vscohover5
youtubehover5
googlehover5
flickrhover5
gmnoprint5
sqs-slice-album-playlistplaying5
audio-player-icons-style-regular5
bandsintownhover5
behancehover5
codepenhover5
dribbblehover5
dropboxhover5
emailhover5
svgsocial-webkit-transitionbackground-color5
6px5
fivehundredpixhover5
facebookhover5
tweet-timestamp5
button-shape-pill5
gm-style-cc5
goodreadshover5
button-shape-rounded-corners5
githubhover5
applepodcasthover5
foursquarehover5
googleplayhover5
data-slice-typebodysqs-slide-wrapperdata-slide-typelock-screen5
5px4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typelock-screen4
4px4
track-title4
video-icon-style-regular4
video-icon-style-solid4
icon-wrapperwidth24pxheight24pxmargin04
use-maskfillfffsqs-slide-wrapperdata-slide-typelock-screen4
tweet-body4
map-style-minimal-dark4
lock-style-border4
ulstacked4
audio-player-icons-style-knockout4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
displaytablesqs-slide-wrapperdata-slide-typelock-screen4
form-itemsqs-slide-wrapperdata-slide-typelock-screen4
ease-in-o-transitionopacity3
only3
inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playlistdemo-album3
button-style-solid3
sqs-slice-album-playliststacked3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
sqs-slidesqs-slide-animation-ready3
ease-in-outtransitioncolor3
button-play-pause3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
adisplayblocksqs-slide-wrapperdata-slide-typelock-screen3
responsive-wrappernotstacked3
screen3
actionssqs-slide-wrapperdata-slide-typelock-screen3
countdown-unit3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typelock-screen3
responsive-wrapper3
responsive-wrapperstackedtext-align-center3
7px3
autoflex13
data-slice-typegallerysqs-gallery-grid3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
gallery-video-backgroundmobile3
ease-in-ms-transitionopacity3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
lock-style-solid3
5emfont14px3
ease-in-moz-transitionopacity3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containernotauto-image-background-color3
video-icon-style-knockout3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
3px3
icon-wrapperwidth28pxheight28pxmargin03
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typelock-screen3
fffsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth32pxheight32pxmargin03
error-messagesqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth36pxheight36pxmargin03
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typelock-screen3
autosqs-slide-wrapperdata-slide-typelock-screen3
ease-intransitionopacity3
lock-style-knockout3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typelock-screen3
disclaimer-containersqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf60sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill000sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperborder2px3
social-icons-size-extra-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-knockout3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-border3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-border3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillff4500sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-knockout3
use-iconfillec4652sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill382110sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille4405fsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf94877sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille0393esqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-solid3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typelock-screen3
1px3
tweet-handle3
arrow-icon3
easesqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b488sqs-slide-wrapperdata-slide-typelock-screen3
inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
avisitedsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillae995asqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillc41200sqs-slide-wrapperdata-slide-typelock-screen3
14px3
tweet-display-name3
tweet-avatar3
use-iconfille52d27sqs-slide-wrapperdata-slide-typelock-screen3
buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
max-width1020pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typeheadingnotdata-compound-type3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-smallsocial-icons-style-regular3
social-icons-size-mediumsocial-icons-style-border3
use-iconfill35465dsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-solid3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-border3
use-iconfillff0031sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-regular3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typelock-screen3
8px3
social-icons-size-largesocial-icons-style-regular3
use-iconfill55aceesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-regular3
sqs-modal-lightbox3

Gwendolina.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Gwendolina.net is a scam?

Websites with Similar Names

Gwendabond.com
Home - Gwenda Bond
Gwendacowart.xyz
404 Not Found
Gwendal-rouillard.fr
Gwendal Rouillard | Député de la 5° circonscription du Morbihan
Gwendalbocher.com
??????????????
Gwendalinebachini.com
La CRI – Gwendaline Bachini | Dance and New media Art
Gwendallebec.com
Gwendal Le Bec - Illustration
Gwendallebihan.net
Apache2 Ubuntu Default Page: It works

Recently Updated Websites

Indentmusic.org 3 seconds ago.Virtueassetmgt.com 3 seconds ago.Airoh.it 3 seconds ago.Halalniche.com 4 seconds ago.Steinsgate0.jp 4 seconds ago.Fashiondesigned.org 4 seconds ago.Keepcalgarypublic.com 5 seconds ago.Vith-connexion.com 5 seconds ago.Automaticintuition.com 5 seconds ago.Memphisdemocrat.com 5 seconds ago.Awagoninthegarden.com 6 seconds ago.Ducadaostastore.com 6 seconds ago.Radicalroutes.org.uk 6 seconds ago.Wurm-ex.cz 7 seconds ago.Diapersluts.com 7 seconds ago.Athenslabsltd.com 7 seconds ago.Msjinnovations.com 8 seconds ago.Barnabyfalls.com 8 seconds ago.Coredr.com 9 seconds ago.Personalwealthacademy.com 9 seconds ago.Whitesocialsecuritydisability.com 10 seconds ago.Animatori.online 10 seconds ago.Griffithbearings.com.au 11 seconds ago.Inkymesspress.com 11 seconds ago.Hdlycbearing.com 11 seconds ago.Mortonchamber.org 11 seconds ago.Deathknellradio.com 12 seconds ago.Battcoop.org 12 seconds ago.Quaifeusa.org 12 seconds ago.Tntdnb.com 13 seconds ago.