Gymnastics | Videos, News & Articles - FloGymnastics

Safety: Low trust score
Year Founded: 2008
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-11
Category: Sports

Gymnastics competitions, videos, news, & articles. Watch & stream live gymnastics events on FloGymnastics.com. Club & Elite Gymnastics events & news coverage.


Domain summary

Domain label
gymnastike
Domain extension
org
Domain registered:
2008-07-16
Domain updated:
2020-10-11
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is gymnastike.org ranked relative to other sites:

Percentage of visits to gymnastike.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Gymnastike.org registered?
A: Gymnastike.org was registered 12 years, 7 months, 1 week, 3 days, 10 hours, 36 minutes, 43 seconds ago on Wednesday, July 16, 2008.
Q: When was the WHOIS for Gymnastike.org last updated?
A: The WHOIS entry was last updated 4 months, 2 weeks, 1 day, 10 hours, 36 minutes, 43 seconds ago on Sunday, October 11, 2020.
Q: What are Gymnastike.org's nameservers?
A: DNS for Gymnastike.org is provided by the following nameservers:
  • ns-1412.awsdns-48.org
  • ns-97.awsdns-12.com
  • ns-1752.awsdns-27.co.uk
  • ns-774.awsdns-32.net
Q: Who is the registrar for the Gymnastike.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Gymnastike.org?
A: Gymnastike.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Gymnastike.org each day?
A: Gymnastike.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Gymnastike.org resolve to?
A: Gymnastike.org resolves to the IPv4 address 151.101.66.114.
Q: In what country are Gymnastike.org servers located in?
A: Gymnastike.org has servers located in the United States.
Q: What webserver software does Gymnastike.org use?
A: Gymnastike.org is powered by webserver.
Q: Who hosts Gymnastike.org?
A: Gymnastike.org is hosted by Consortium GARR in United States.
Q: How much is Gymnastike.org worth?
A: Gymnastike.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Gymnastike.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Gymnastike.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Gymnastike.org

H1 Headings

1 :
  1. How To Tape Wrist Rips With Al Fong

H2 Headings

0 :

H3 Headings

6 :
  1. Trending
  2. Headlines
  3. Most Watched
  4. Headlines
  5. Events
  6. Most Watched

H4 Headings

17 :
  1. W&M Gymnastics Teams Cut
  2. Minnesota Cutting Men's Gymnastics
  3. AF Announces Freshmen Class
  4. Rutgers Announces 12 Newcomers
  5. Help Save College Gymnastics Programs
  6. Sunisa Lee: Grace Under Pressure
  7. William & Mary Are The Latest School To Cut Gymnastics
  8. Top 2020 NCAA Routines To Re-Watch
  9. Miss Val: Finding Joy And Appreciation
  10. Beyond The Routine: Riley McCusker's
  11. 7 Routines From The Metroplex Challenge You Need To Rewatch
  12. Replay: CA Grand Invite & Collegiate Challenge - Floor
  13. Inside UCLA's Killer Conditioning
  14. Rutgers Announces 12 Newcomers
  15. Alignment Drill For Single-Leg Acro Landings
  16. An Open Letter To Little Gymnasts
  17. How You Can Help Save Collegiate Gymnastics Programs

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

17 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

31:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Gymnastike.org

right100 heightsportshrefqhttpswwwflogymnasticscomrankingsqgimmerselagingredientshobbiestargetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla21pro events livemembernationalstream live gymnasticsmenarsquoshrefqhttpswwwflogymnasticscomsignupqgsignall flosports sitestherearticlesbeamhrefqhttpswwwflorugbycomqgflorugbylaglliglliglasmallacross alltargetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomqthoseprogramshrefqhttpwwwflowrestlingcomqstillannounces 12hrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglliglareallymajorrelqnoopener noreferrerqfrdraggableqheighthrefqhttpswwwflovoicecomqgflovoicelaglliglliglahrefqhttpstwittercomflogymnasticsqyour favorite collegeimpactariahiddenqtrueq classqfawilliam aamp marydifferenceandroidlpglpglstrong dataredactortagqstrongqgstreaminganbsplstronggpronow haverutgers becausesites listed abovelpglhrglh2ghow15 returnershas two brothersbig4national honorclub a eliteeffectstargetqblankqgemailevennewhrefqhttpswwwfloracingcomqgfloracinglaglliglliglayearsflogymnasticsgymnastics needs yourcantargetqblankqgflocombatlaglliglliglahrefqhttpwwwflocheercomqgoodtapevideos newscamden countyhrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwithhrefqhttpswwwflogymnasticscomrankingsqgimmerselag yourselfhrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith your annualflosports sitestargetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglliglahrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomqngcontentc7qqgliotherreplayvideoslive gymnastics eventsmeetssomethingbeyondhighlightsright place flogymnasticsdataredactortagqstrongqgdownload the appsanbsplstronggnow521234articles watchandash lstronggcbdaamp marysincegettingsunisa leehrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglliglaifhrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomqviewboxq0 0hrefqhttpswwwflogymnasticscomsignupqgsign upaccess to allappsanbsplstronggnowyourselfathletes oftendataaosqq dataaosoffsetq100qfavorite collegeappqqseodescriptionqqget the flosportscompetitivehrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglliglaflogymnastics youiosaftermusclewilliam aamptwitter la hrefqhttpstwittercomflogymnasticsqyour bodyhrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglliglaarticles clubneeds your helpsometargetqblankqgflograpplinglaglliglliglaqualifierflosports appqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq20151019t2057450000qqmodifiedatqq20200702t1928580000qqassetqqidq7097591qtitleqqgetsoright placenews a articlesxmlnsqhttpwwww3org2000svgqperfectregionalshas announcedneeds yourevents on flogymnasticscomhrefqhttpstwittercomflogymnasticsq idqidgpn470qvarsityathleticsathlete documentaries9 statesitesresultjuniorfeaturingsoftballanbsplpglpgbe therelpglpgyou nowlstronggcbdnewsroutinesappqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq20151019t2057450000qqmodifiedatqq20200702t1928580000qqassetqqidq7097591qtitleqqgethrefqhttpswwwfacebookcomflogymnasticsq idqidgpn613q relqnoopenerourmakegymnastics programwilliam a maryneedngcontentc7qqgli ngcontentc7qq ariahiddenqtrueqnoreferrerq targetqblankqgfacebooklaglpgqqdescriptionplainqqgetrx sports producerannouncesnowhigh10 stateboard20varietybeing cut signnewesthrefqhttpwwwflovolleyballcomqhrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla0 500announces freshmeninvitefeltdataredactortagqstrongqgstreaminganbsplstronggpronicknamewaldmanhrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglliglapetition makefamilyahellip nationalmorehrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwithinternational and proexclusive athleteyour annualopenacademicshrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongginstagram la hrefqhttpswwwinstagramcomflogymnasticsqfoundsix freshmeneliminatedhrefqhttpswwwflosoftballcomqthey deserveanbsplpglpgladataverifiedqredactorqgla hrefqhttpwwwflosportstvqseegrandtrackannual proahellip hobbieslittleuse19has twocan helpisnarsquothsondemandanbsplpglpgla hrefqhttpswwwflogymnasticscomrankingsqgimmerselag yourselfcurrentpremium content acrossstronger togetherresearchgymnastics competitionshadcouldcamepremiumtheyfloridasistersheight autoq classqfrficphysical12countryidqidgpn560q relqnoopener noreferrerqworldableroku amazonhrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomqhrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag newbodyqqdisplaynameqnullqslugqqgoverningbodyqqparentqnullqcreatedatqq20190813t1625510000qqmodifiedatqq20200429t0402110000qqdescriptionqqlpgif you liveintenseidqidgpn296qgflosoftballlaglliglliglasureprostudiestargetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomqfavorite college clubpracticejo nationalschool to cutaccessfarannouncedmetroplextape wristalthoughbreathe gymnasticsexclusivetargetqblankqgfacebooklaglpgqqdescriptionplainqqget the flosportsrankings la hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlaghrefqhttpswwwflogymnasticscomsignupqgsign up herelaglpglhrglh2gjoin1our trainingclub internationalwristhrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglliglaenergyteamhrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglligladohrefqhttpwwwflocombatcomqhrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglliglathandirqltrqgwilliam aamp marybecauseforce womenssamazon tvdoesthrough the cgauclahrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglliglahrefqhttpswwwflogymnasticscomeventsqgwatchlag yourexclusive athlete documentarieshrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglliglacontenttargetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglliglatargetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglliglaevents a newshrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglliglaondemandanbsplpglpglahrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongg verticalslpglulglliglawayproducer of worldclasszfirstregional qualifierdataredactortagqstrongq dataverifiedqredactorqgla hrefqhttpwwwflosportstvqflogymnasticscom gymnastics competitions11 octrxplanseventstyleqtextalignwatchlh2glpglstrongpremium contentworldclassemail or donatengcontentc5qqnews gymnasticsregardingidqidgpn613q relqnoopener noreferrerqheight autoqcut signflosports appqqdescriptionqnullqcreditqnullqsourceqqhttpsdamb2tknfsommcloudfrontnetuploadedlqbzdlmbk0kglzzmjzqg9donye9jneqwimages00001jpgqqsiteqqdomainqqwwwflogymnasticscomqqidq4qnameqqflogymnasticsqqcodeqqflogymnasticsqqhostqqhttpswwwflogymnasticscomqqactiveqtrueqtypeqqsiteqqversionq3qcolorqqff140fqqheroimageqqhttpsd6fm3yzmawlcscloudfrontnetmobileverticalbackgroundmobilebgflogymnasticsjpgqqmodifiedatqnullqshowonmobileqtrueqsportnameqqgymnasticsqqurlqqhttpsd2779tscntxxswcloudfrontnetlqbzdlmbk0kglzzmjzqg9donye9jneqwjpgqqlibraryqfalseqstatuscodeqnullqpathqnullqcopiedqfalseqduplicatedqfalseqcreatedatqq20200929t1621590000qqmodifiedatqnullqlogoqnullqslugqqgettheflosportsappqqpublishstartdateqq20200929t1620000000qqpublishenddateqnullqstatusq1qstatustextqqactivepro subscriptionclassplayers and teamsariahiddenqtrueqincludeahellip graduatedapplesubscriptiondirqltrq styleqtextalignplacepeoplecollege gymnastics programsncaahonor societylevel 9newcomers will joinwrist ripshrefqhttpswwwinstagramcomflogymnasticsqidqidgpn560q relqnoopenertargetqblankqgfacebooklaglpgqqdescriptionplainqqgetgotargetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomqherelaglpglhrglh2gjoinidqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglliglabrotherstherelpglpgyouathletes havetargetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomqtogether14losingneedscampaigntherelpglpgyou now0521 234521idqidgpn470q relqnoopener noreferrerqwatch a streamlivedeserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlag yoursignlibraryhrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglliglawomenssflogymnastics you gaintopcareerrutgerstheirhrefqhttpswwwinstagramcomflogymnasticsq idqidgpn560q relqnoopenerjoin 15 returnerscompetitions videoslovegymtheir gymnasticsdiversitygymnastics teamidqidgpn613q relqnoopenerathleticariahiddenqtrueq classqfa fachevronright11 oct 2020500qhonorstowards a careerhrefqhttpswwwflogymnasticscomeventsqgwatchlag your favoriteour training libraryworldclass cbdyou gaintowardstargetqblankqgflorodeolaglliglliglabodyqqdisplaynameqnullqslugqqgoverningbodyqqparentqnullqcreatedatqq20190813t1625510000qqmodifiedatqq20200429t0402110000qqdescriptionqqlpgifseasonalsosaveemailour teamgymnastics needssave collegiate gymnasticsnational honor societyahellip nicknameprimarycolorbgqgliglh4likecoachcalled6hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglliglaassociationtechniquessociallh2glpgfollowstreamtargetqblankqgvarsitytvlaglliglliglaahellip national honorhrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglliglatv0 500 500qyou gain accessheadwomena39shrefqhttpwwwflohoopscomqways you cancoacheslauratargetqblankqgflosportslaglstronggyou canyour annual profree radicalsflosports appqqshorttitleqqgetgetcollegiate challengemarshstyleqwidthngcontentc7qqwomenss gymnasticshrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomqngcontentc7qq ariahiddenqtrueqhrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligladocumentariesgymnastamazon tv apple11terpenesthatarsquosyearlibrary la hrefqhttpswwwflogymnasticscomfilmsqgenjoylag17all flosportsstyleqwidth 100breatheweeksave collegiatenoreferrerqjuststressyoutherelpglpgyou now havepassionate about givingabovelpglhrglh2ghowapple tv 4rx sportsdataredactortagqstrongqahellip parentsstrongertargetqblankqgflogymnasticslaglpglpgfollowclaimsidqidgpn470qdivisioncommunityhrefqhttpswwwflogymnasticscomfilmsqgenjoylag exclusive athletesport and itsngcontentc5qq ariahiddenqtrueqathletesprohibitedhelp save collegiateoftenherelaglpglhrglh2gjoin the conversationmultiplehrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglliglanews gymnastics competitionssoftballanbsplpglpgbe therelpglpgyouidqidgpn560qhelpssportclassqfa fachevronrightfreedona39t havesquadrondirqltrqgwilliam aampcga stronger togetherwrite an emailhrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligladisappointing5pandemicfeelmake a calldona39tplayersinternationaloct 2020appqqshorttitleqqgetyour helpahellipyour trainingsleeptargetqblankqgflovolleyballlaglliglliglatargetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglliglacountypetitionhrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomqjordanmenarsquos gymnasticsyou can helpdirqltrqsoftballanbsplpglpgbeviewboxq0hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith yourhas partneredclassqfahrefqhttpswwwfacebookcomflogymnasticsq idqidgpn613qhardcadataverifiedqredactorqglateamsdeserveanbsplpglpglagymnasts grapplerelqnoopener noreferrerq targetqblankqgflogymnasticslaglpglpgfollowhrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglliglaaffecthelp savesalimbeasleycompanygaby johaneknsaidshrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomqgain accesslatestwhichexperiencetribehrefqhttpwwwfloelitecomqwatchlh2glpglstrong dataredactortagqstrongqgdownloadca grandbetween a kasamatsudirqltrqgwilliamverticalslpglulglliglahitqqxcachehitsqq0previousallhrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglliglagymnastics eventsandroidlpglpglstrong dataredactortagqstrongqgstreaminganbsplstronggpro accesstv apple tvpriorgrapple9hrefqhttpswwwinstagramcomflogymnasticsq idqidgpn560qwaampmdidnarsquotthey deserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlagprograms from beingcga strongerdataaosqqalumnitv appletargetqblankqgflosportslaglstrongg verticalslpglulglliglateam hasstate and regionalnewcomerscgahrefqhttpwwwmilesplitcomqsociallh2glpgfollow usacrohrefqhttpswwwflogymnasticscomeventsqgwatchlagproductsthoughgivingchose rutgersuptargetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomqtv 4 ioseveryoneflogymnasticscomhrefqhttpwwwflosportstvqsimplyhrefqhttpwwwflotrackorgqeffectiveflosports appqqseodescriptionqqgetinvolvedmore thanleadhrefqhttpswwwflohockeytvqgflohockeylaglliglliglaondemandanbsplpglpgla hrefqhttpswwwflogymnasticscomrankingsqgimmerselagbothbodyhrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomqbeenabovelpglhrglh2ghow to watchlh2glpglstronghrefqhttpwwwflomarchingcomqnjtargetqblankqgflogymnasticslaglpglpgfollow usacademicdeserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlaggymnastics teamsproducedusnoreferrerq targetqblankqgflogymnasticslaglpglpglike usfriendsgymnastics youa39repartnered with rxtargetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvqhelp to save0521classqfroalaimageqverticalslpglulglligla hrefqhttpwwwmilesplitcomqfloorcbdovergabausingscholaryour workoutmycuttingnewest scarletngcontentc7qqgli ngcontentc7qqremovedlike cbdsixavailable on rokuamazoncbd products perfectsign a petitionoxidative stressripsmonthsengineeringhrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomqcontinuetargetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglliglalevelcall writegymnastsocttraining recoveryjoin 15havehslstrongglpglpglstronggnoteslstronggchoseyour training recoveryrollrelqnoopener noreferrerq targetqblankqgflogymnasticslaglpglpglikemost belovedcompetitions videos newsappqqdescriptionqnullqcreditqnullqsourceqqhttpsdamb2tknfsommcloudfrontnetuploadedlqbzdlmbk0kglzzmjzqg9donye9jneqwimages00001jpgqqsiteqqdomainqqwwwflogymnasticscomqqidq4qnameqqflogymnasticsqqcodeqqflogymnasticsqqhostqqhttpswwwflogymnasticscomqqactiveqtrueqtypeqqsiteqqversionq3qcolorqqff140fqqheroimageqqhttpsd6fm3yzmawlcscloudfrontnetmobileverticalbackgroundmobilebgflogymnasticsjpgqqmodifiedatqnullqshowonmobileqtrueqsportnameqqgymnasticsqqurlqqhttpsd2779tscntxxswcloudfrontnetlqbzdlmbk0kglzzmjzqg9donye9jneqwjpgqqlibraryqfalseqstatuscodeqnullqpathqnullqcopiedqfalseqduplicatedqfalseqcreatedatqq20200929t1621590000qqmodifiedatqnullqlogoqnullqslugqqgettheflosportsappqqpublishstartdateqq20200929t1620000000qqpublishenddateqnullqstatusq1qstatustextqqactivevery18watchalumni and currenttargetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgqtargetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglliglathreecampusprogramsavewmgymnotlstronghrefqhttpwwwflorodeocomqroku amazon tvamazingavailablechallengesites listedrelqnoopener noreferrerq targetqblankqgfacebooklaglpgqqdescriptionplainqqgetdonate to getexperience theyroutinedifference betweenjohanekhead coachtargetqblankqgflocheerlaglliglliglaup herelaglpglhrglh2gjointhroughhrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvqforcehrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgqhealthbelovedtargetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglliglamost beloved playersways youhrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglliglaletterputnoreferrerq targetqblankqgflogymnasticslaglpglpglikestyleqwidth 100 heightcurrent gymnasts grapplethree siblingsmany athletesdataredactortagqstrongqgstreaminganbsplstronggpro accesssupporthrefqhttpwwwflograpplingcomqclassqcolmd4hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag new techniquesmayannualjoinhrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglliglaexperience they deserveanbsplpglpgla3nolevel 9 statescarlet knightssocietyahellipdaughterknightsgiving the sportwaysinstagramitssubscription on flogymnasticsbodyqqdisplaynameqnullqslugqqgoverningbodyqqparentqnullqcreatedatqq20190813t1625510000qqmodifiedatqq20200429t0402110000qqcreatedatqq20191022t1651510000qqmodifiedatqq20200429t0402360000qqsluguriqqcollectionstagartisticqqidq40456qnameqqartisticqqdisplaynameqnullqslugqqartisticqqparentqqsluguriqqcollectionstageventtypeqqidq38918qnameqqeventnow have accesspotentialtargetqblankqgdonate throughsites la hrefqhttpswwwflogymnasticscomsignupqgsignproducts perfectsports producersocialbaranxietytraining librarytargetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglliglatrainingidqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglliglaschoolclubgainawardbenefitssunisawomenarsquosathletemediatargetqblankqgflowrestlinglaglliglliglapainshowrosterhrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglliglacollegiatebeingbackreturnersmosthrefqhttpswwwflogymnasticscomfilmsqgenjoylag exclusivengcontentc5qq ariahiddenqtrueq classqfatimetechniques in ourappsanbsplstronggnow availableperfect for yourahellip haspassionateseniorcannabinoidshrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglliglaaamphrefqhttpswwwflobikescomqgflobikeslaglliglliglacompaniestargetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomqvaltargetqblankqgflosportslaglstrongg verticalslpglulglligla hrefqhttpwwwmilesplitcomqgymnastics teams beingtargetqblankqgflohoopslaglliglliglarileyadditionthemrankingscompetitionsxmlnsqhttpwwww3org2000svgq viewboxq0 0lessbreathe gymnastics youa39rehrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglliglateams beinghourscollege clubtargetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomqeventscollege club international0directlyconversationcuthrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglliglanicholsbalancehrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglliglahrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglliglaannual pro subscriptionhernoreferrerq targetqblankqgflogymnasticslaglpglpgfollowhrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglliglaabilitychose rutgers becauseplans to major13beyond the routine2020 224850toughelite gymnastics eventsahellip planstv 4pushingits fansappqqshorttitleqqget the flosportswilliamjoviewboxq0 0 500publishedqqstatuscolorqqcdeb8bqqpremiumqfalseqnodeqqcategoriesqqsluguriqqcollectionstagnewsqqidq15qnameqqnewsqqdisplaynameqnullqslugqqnewsqqparentqqsluguriqqcollectionstagcontenttypeqqidq1qnameqqcontenthelpstaterokureasonsafenightbenefitflogymnasticscom gymnasticsgymnastics competitions videosworldclass cbd productssocietyneverahellip has twowe dona39t haveoneaddition of sixlistedautoq classqfrficthingsproducermuchsave programs234521being cuttargetqblankqgfloelitelaglliglliglaonlyget involvedpartners with rxwehrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglliglaworkoutshasmanyapple tvgabyclassqfrfichrefqhttpswwwfacebookcomflogymnasticsqtargetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglliglabetweennewest scarlet knightslee12 newcomersusedpro eventsgreatreadydecisionbodyqqdisplaynameqnullqslugqqgoverningbodyqqparentqnullqcreatedatqq20190813t1625510000qqmodifiedatqq20200429t0402110000qqdescriptionqqlpgif youfunctionhrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwithhonor100 height autoqwe dona39tscarletconditioningsiblingstargetqblankqgflogymnasticslaglpglpglike ustwo brotherschampionfansproducthrefqhttpwwwvarsitytvqtargetqblankqgmilesplitlaglliglliglagraduatedandashmary cutvaultoutautoqacademynot onlyfavorite7wellcollegiate gymnastics4 iosios and androidlpglpglstrongtwitteralaskahrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglliglahrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomqaccess to premiumstream liveflosportstargetqblankqgflotracklaglliglliglatargetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomqflogymnasticscom clubidqidgpn470q relqnoopenerrecoverydatafeathrclicktrackqtrueqdonatehrefqhttpswwwflogymnasticscomtrainingqgdiscoverlaghrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith yourlevel 10 statetherapeuticoct 2020 224850grand invitebeautifulyou livelive gymnasticsconversation on sociallh2glpgfollow215knowfinancialyour10inflammationpushing back22barscamdengymnastics programsnew techniqueslisted abovelpglhrglh2ghowhrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglligla25noreferrerq targetqblankqgflogymnasticslaglpglpgfollow uspressurecallsharedampxmlnsqhttpwwww3org2000svgq viewboxq0content acrossstudentoxidativerossevents livehave foundngcontentc7qq ariahiddenqtrueq classqfayour favoriteminorbutngcontentc5qq classqcolmd4lpathandroidlpglpglstrongmeans521 521can help saveeliteyoua39relstrong dataredactortagqstrongqlive and breathelevel 10emilyplace flogymnasticsdaytargetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomqolympicsthesefillqcurrentcolorq8flogymnastics is passionatefacilitiesdataredactortagqstrongq dataverifiedqredactorqglaanysociety ahellipaddition of 12comeshave accesspartnersappqqseodescriptionqqgettargetqblankqgflogymnasticslaglpglpglikefachevronrightmetroplex challengehowevercurrent gymnastsradicalsmaryallaroundhrefqhttpstwittercomflogymnasticsq idqidgpn470q relqnoopenertargetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomqamounthrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomqwritelstrong dataredactortagqstrongq dataverifiedqredactorqglaparents1624beloved playersus on instagramhrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglliglalive or ondemandanbsplpglpglacollegecbd productsfans the experience23thentape wrist ripscontent across allfreshmenelite gymnasticsbeforeca grand invitedataverifiedqredactorqgla hrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongghrefqhttpswwwfloswimmingcomqgfloswimminglaglliglliglaacrosssisterita39steams in softballanbsplpglpgberegionaltargetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglliglaworkoutathletic departmentantioxidant0 521234twoidqidgpn613qkasamatsuhrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglliglahrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglliglaannounced the additionhrefqhttpswwwflogymnasticscomfilmsqgenjoylagstate floortargetqblankqgflomarchinglaglliglliglatruedepartment500 500qdrillconsiderlisttargetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglligladataaosoffsetq100qappqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq20151019t2057450000qqmodifiedatqq20200702t1928580000qqassetqqidq7097591qtitleqqget the flosportsus on twittercompeteboard of visitorswomenarsquos gymnasticssciencetenqqdisplaynameqnullqslugqqbigtenqqparentqqsluguriqqcollectionstagconferenceqqidq38919qnameqqconferenceqqdisplaynameqnullqslugqqconferenceqqparentqnullqcreatedatqq20190813t1626090000qqmodifiedatqq20200429t0402110000qqcreatedatqq20191022t1651500000qqmodifiedatqq20200429t0402170000qqsluguriqqcollectionstagncaaqqidq40455qnameqqncaaqqdisplaynameqnullqslugqqncaaqqparentqqsluguriqqcollectionstaggoverningbodyqqidq38917qnameqqgoverningrelqnoopenerlatest schoolverticalslpglulglligla hrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglliglagymnasticscutspartneredtargetqblankqgdonatecollege gymnasticsdataredactortagqstrongqgdownloadwerevisitorscompetitive athletesuniversity

Longtail Keyword Density for Gymnastike.org

KeywordsOccurences
elite gymnastics events17
events a news17
stream live gymnastics17
live gymnastics events17
events on flogymnasticscom17
club a elite17
news a articles16
competitions videos news15
william aamp mary12
watch a stream9
gymnastics competitions videos8
flogymnasticscom gymnastics competitions8
national honor society8
towards a career8
11 oct 20206
oct 2020 2248506
announced the addition6
aria-hiddenqtrueq classqfa fa-chevron-right6
ngcontent-c7qq aria-hiddenqtrueq classqfa6
ngcontent-c7qqgli ngcontent-c7qq aria-hiddenqtrueq6
chose rutgers because6
access to all6
gymnastics needs your5
needs your help5
plans to major5
ca grand invite4
write an email4
dirqltrqgwilliam aamp mary4
make a call4
board of visitors4
donate to get4
email or donate4
sites la hrefqhttpswwwflogymnasticscomsignupqgsign3
abovelpglhrglh2ghow to watchlh2glpglstrong3
data-redactor-tagqstrongqgdownload the appsanbsplstronggnow3
conversation on sociallh2glpgfollow3
herelaglpglhrglh2gjoin the conversation3
hrefqhttpswwwflogymnasticscomsignupqgsign up herelaglpglhrglh2gjoin3
ios and androidlpglpglstrong3
all flosports sites3
androidlpglpglstrong data-redactor-tagqstrongqgstreaminganbsplstronggpro access3
available on roku3
tv 4 ios3
apple tv 43
tv apple tv3
roku amazon tv3
amazon tv apple3
sites listed abovelpglhrglh2ghow3
tape wrist rips3
content across all3
hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith3
idqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglligla3
hrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglligla3
hrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglligla3
hrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla3
hrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglligla3
hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla3
hrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla3
hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla3
hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith your3
premium content across3
hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith your annual3
your annual pro3
annual pro subscription3
twitter la hrefqhttpstwittercomflogymnasticsq3
subscription on flogymnastics3
flogymnastics you gain3
you gain access3
access to premium3
us on twitter3
william a mary3
hrefqhttpstwittercomflogymnasticsq idqidgpn470q relqnoopener3
through the cga3
ahellip has two3
has two brothers3
level 10 state3
ahellip national honor3
addition of 123
state and regional3
level 9 state3
cga stronger together3
college gymnastics programs3
ways you can3
partnered with rx3
rx sports producer3
producer of world-class3
world-class cbd products3
cbd products perfect3
perfect for your3
addition of six3
we dona39t have3
idqidgpn470q relqnoopener noreferrerq3
noreferrerq targetqblankqgflogymnasticslaglpglpglike us3
relqnoopener noreferrerq targetqblankqgflogymnasticslaglpglpgfollow3
noreferrerq targetqblankqgflogymnasticslaglpglpgfollow us3
us on instagram3
instagram la hrefqhttpswwwinstagramcomflogymnasticsq3
hrefqhttpswwwinstagramcomflogymnasticsq idqidgpn560q relqnoopener3
idqidgpn560q relqnoopener noreferrerq3
relqnoopener noreferrerq targetqblankqgflogymnasticslaglpglpglike3
hrefqhttpswwwfacebookcomflogymnasticsq idqidgpn613q relqnoopener3
height autoq classqfr-fic3
idqidgpn613q relqnoopener noreferrerq3
relqnoopener noreferrerq targetqblankqgfacebooklaglpgqqdescriptionplainqqget3
targetqblankqgfacebooklaglpgqqdescriptionplainqqget the flosports3
newcomers will join3
join 15 returners3
hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglligla3
styleqwidth 100 height3
100 height autoq3
hrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglligla3
targetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglligla3
targetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomq3
sport and its3
appqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq2015-10-19t2057450000qqmodifiedatqq2020-07-02t1928580000qqassetqqidq7097591qtitleqqget the flosports3
bodyqqdisplaynameqnullqslugqqgoverning-bodyqqparentqnullqcreatedatqq2019-08-13t1625510000qqmodifiedatqq2020-04-29t0402110000qqdescriptionqqlpgif you live3
live and breathe3
breathe gymnastics youa39re3
right place flogymnastics3
flogymnastics is passionate3
passionate about giving3
giving the sport3
fans the experience3
appqqshorttitleqqget the flosports3
experience they deserveanbsplpglpgla3
they deserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlag3
deserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlag your3
hrefqhttpswwwflogymnasticscomeventsqgwatchlag your favorite3
your favorite college3
favorite college club3
college club international3
international and pro3
appqqseodescriptionqqget the flosports3
0 500 500q3
live or on-demandanbsplpglpgla3
can help save3
between a kasamatsu3
school to cut3
alumni and current3
current gymnasts grapple3
gymnastics teams being3
beyond the routine3
newest scarlet knights3
you can help3
help save collegiate3
viewboxq0 0 5003
save collegiate gymnastics3
help to save3
programs from being3
being cut sign3
sign a petition3
ngcontent-c5qq aria-hiddenqtrueq classqfa3
news gymnastics competitions3
xmlnsqhttpwwww3org2000svgq viewboxq0 03
pro events live3
on-demandanbsplpglpgla hrefqhttpswwwflogymnasticscomrankingsqgimmerselag yourself3
hrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla3
hrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomq3
hrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgq3
targetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglligla3
hrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomq3
targetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglligla3
hrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomq3
targetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglligla3
hrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomq3
partners with rx3
targetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglligla3
hrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomq3
hrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvq3
targetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglligla3
hrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomq3
targetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglligla3
hrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomq3
targetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglligla3
hrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomq3
targetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglligla3
targetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglligla3
targetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglligla3
rankings la hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag3
teams in softballanbsplpglpgbe3
hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag new techniques3
techniques in our3
our training library3
library la hrefqhttpswwwflogymnasticscomfilmsqgenjoylag3
hrefqhttpswwwflogymnasticscomfilmsqgenjoylag exclusive athlete3
exclusive athlete documentaries3
most beloved players3
players and teams3
softballanbsplpglpgbe therelpglpgyou now3
hrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomq3
therelpglpgyou now have3
now have access3
lstrong data-redactor-tagqstrongq data-verifiedqredactorqgla3
data-redactor-tagqstrongq data-verifiedqredactorqgla hrefqhttpwwwflosportstvq3
data-verifiedqredactorqgla hrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongg3
hrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongg verticalslpglulglligla3
targetqblankqgflosportslaglstrongg verticalslpglulglligla hrefqhttpwwwmilesplitcomq3
verticalslpglulglligla hrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglligla3
your training recovery3
gymnastics events34
relqnoopener noreferrerq31
videos news19
competitions videos18
aamp mary18
elite gymnastics18
live gymnastics17
stream live17
william aamp14
level 1013
gymnastics competitions11
menarsquos gymnastics10
gymnastics teams10
gymnastics team10
aria-hiddenqtrueq classqfa9
rx sports9
rutgers because9
jo national9
flogymnasticscom club9
articles club8
articles watch8
you can8
national honor8
honor society8
level 98
college gymnastics8
flogymnasticscom gymnastics8
oct 20207
data-aosqq data-aos-offsetq100q7
ngcontent-c7qq aria-hiddenqtrueq6
classqfa fa-chevron-right6
cbd products6
ngcontent-c7qqgli ngcontent-c7qq6
2020 2248506
two brothers6
gymnastics needs6
11 oct6
ahellip parents6
across all6
chose rutgers6
ahellip graduated6
news gymnastics5
viewboxq0 05
ahellip nickname5
andash lstronggcbd5
being cut5
your help5
needs your5
collegiate gymnastics5
ahellip plans5
your body5
ahellip has5
announces freshmen5
womenss gymnastics5
announces 125
more than5
state floor4
force womenss4
womenarsquos gymnastics4
dirqltrq styleqtext-align4
we dona39t4
ahellip national4
three siblings4
dirqltrqgwilliam aamp4
have found4
oxidative stress4
collegiate challenge4
petition make4
grand invite4
call write4
ca grand4
get involved4
newest scarlet4
metroplex challenge4
521 5214
stronger together4
free radicals4
their gymnastics3
pushing back3
mary cut3
roku amazon3
appsanbsplstronggnow available3
watchlh2glpglstrong data-redactor-tagqstrongqgdownload3
15 returners3
join 153
noreferrerq targetqblankqgfacebooklaglpgqqdescriptionplainqqget3
idqidgpn613q relqnoopener3
hrefqhttpswwwfacebookcomflogymnasticsq idqidgpn613q3
hrefqhttpswwwflogymnasticscomsignupqgsign up3
tv apple3
targetqblankqgflogymnasticslaglpglpglike us3
androidlpglpglstrong data-redactor-tagqstrongqgstreaminganbsplstronggpro3
sociallh2glpgfollow us3
hrefqhttpstwittercomflogymnasticsq idqidgpn470q3
idqidgpn470q relqnoopener3
flosports sites3
all flosports3
data-redactor-tagqstrongqgstreaminganbsplstronggpro access3
noreferrerq targetqblankqgflogymnasticslaglpglpgfollow3
4 ios3
amazon tv3
targetqblankqgflogymnasticslaglpglpgfollow us3
hrefqhttpswwwinstagramcomflogymnasticsq idqidgpn560q3
idqidgpn560q relqnoopener3
noreferrerq targetqblankqgflogymnasticslaglpglpglike3
tv 43
apple tv3
up herelaglpglhrglh2gjoin3
tape wrist3
12 newcomers3
athletic department3
sports producer3
camden county3
not only3
targetqblankqgdonate through3
cga stronger3
ways you3
has partnered3
world-class cbd3
many athletes3
products perfect3
your training3
training recovery3
like cbd3
athletes have3
your workout3
athletes often3
9 state3
regional qualifier3
gaby johanek3
our team3
styleqwidth 1003
100 height3
height autoq3
autoq classqfr-fic3
dona39t have3
gymnastics program3
gymnastics programs3
team has3
sites listed3
has announced3
six freshmen3
head coach3
society ahellip3
ahellip hobbies3
has two3
10 state3
listed abovelpglhrglh2ghow3
targetqblankqgflomarchinglaglliglligla hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla3
content across3
club international3
right place3
place flogymnastics3
its fans3
experience they3
they deserveanbsplpglpgla3
deserveanbsplpglpgla hrefqhttpswwwflogymnasticscomeventsqgwatchlag3
hrefqhttpswwwflogymnasticscomeventsqgwatchlag your3
your favorite3
favorite college3
college club3
pro events3
breathe gymnastics3
events live3
on-demandanbsplpglpgla hrefqhttpswwwflogymnasticscomrankingsqgimmerselag3
hrefqhttpswwwflogymnasticscomrankingsqgimmerselag yourself3
hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag new3
new techniques3
our training3
training library3
hrefqhttpswwwflogymnasticscomfilmsqgenjoylag exclusive3
exclusive athlete3
athlete documentaries3
most beloved3
gymnastics youa39re3
you live3
softballanbsplpglpgbe therelpglpgyou3
save programs3
difference between3
sunisa lee3
latest school3
current gymnasts3
gymnasts grapple3
teams being3
scarlet knights3
can help3
help save3
save collegiate3
cut sign3
bodyqqdisplaynameqnullqslugqqgoverning-bodyqqparentqnullqcreatedatqq2019-08-13t1625510000qqmodifiedatqq2020-04-29t0402110000qqdescriptionqqlpgif you3
ngcontent-c5qq classqcol-md-43
ngcontent-c5qq aria-hiddenqtrueq3
xmlnsqhttpwwww3org2000svgq viewboxq03
0 5003
500 500q3
0-521 234-5213
0 521-2343
flosports appqqshorttitleqqget3
flosports appqqseodescriptionqqget3
flosports appqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq2015-10-19t2057450000qqmodifiedatqq2020-07-02t1928580000qqassetqqidq7097591qtitleqqget3
flosports appqqdescriptionqnullqcreditqnullqsourceqqhttpsdamb2tknfsommcloudfrontnetuploadedlqbzdlmbk0kglzzmjzqg9donye9jneqwimages00001jpgqqsiteqqdomainqqwwwflogymnasticscomqqidq4qnameqqflogymnasticsqqcodeqqflogymnasticsqqhostqqhttpswwwflogymnasticscomqqactiveqtrueqtypeqqsiteqqversionq3qcolorqqff140fqqheroimageqqhttpsd6fm3yzmawlcscloudfrontnetmobileverticalbackgroundmobilebgflogymnasticsjpgqqmodifiedatqnullqshowonmobileqtrueqsportnameqqgymnasticsqqurlqqhttpsd2779tscntxxswcloudfrontnetlqbzdlmbk0kglzzmjzqg9donye9jneqwjpgqqlibraryqfalseqstatuscodeqnullqpathqnullqcopiedqfalseqduplicatedqfalseqcreatedatqq2020-09-29t1621590000qqmodifiedatqnullqlogoqnullqslugqqget-the-flosports-appqqpublishstartdateqq2020-09-29t1620000000qqpublishenddateqnullqstatusq1qstatustextqqactive3
beloved players3
therelpglpgyou now3
premium content3
hrefqhttpswwwflorugbycomqgflorugbylaglliglligla hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla3
hrefqhttpwwwflorodeocomq targetqblankqgflorodeolaglliglligla3
targetqblankqgflorodeolaglliglligla hrefqhttpwwwflomarchingcomq3
hrefqhttpwwwflomarchingcomq targetqblankqgflomarchinglaglliglligla3
wrist rips3
hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla hrefqhttpswwwflosoftballcomq3
hrefqhttpswwwflosoftballcomq idqidgpn296qgflosoftballlaglliglligla3
idqidgpn296qgflosoftballlaglliglligla hrefqhttpswwwflohockeytvqgflohockeylaglliglligla3
hrefqhttpswwwflohockeytvqgflohockeylaglliglligla hrefqhttpswwwfloracingcomqgfloracinglaglliglligla3
hrefqhttpswwwfloracingcomqgfloracinglaglliglligla hrefqhttpswwwflovoicecomqgflovoicelaglliglligla3
hrefqhttpswwwflovoicecomqgflovoicelaglliglligla hrefqhttpswwwflorugbycomqgflorugbylaglliglligla3
hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla hrefqhttpswwwflobikescomqgflobikeslaglliglligla3
hrefqhttpwwwflohoopscomq targetqblankqgflohoopslaglliglligla3
hrefqhttpswwwflobikescomqgflobikeslaglliglligla hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla3
hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla3
hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla3
hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith3
hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith your3
your annual3
annual pro3
pro subscription3
flogymnastics you3
you gain3
gain access3
targetqblankqgflohoopslaglliglligla hrefqhttpwwwflorodeocomq3
targetqblankqgvarsitytvlaglliglligla hrefqhttpwwwflohoopscomq3
now have3
targetqblankqgflowrestlinglaglliglligla hrefqhttpwwwfloelitecomq3
have access3
lstrong data-redactor-tagqstrongq3
data-redactor-tagqstrongq data-verifiedqredactorqgla3
data-verifiedqredactorqgla hrefqhttpwwwflosportstvq3
hrefqhttpwwwflosportstvq targetqblankqgflosportslaglstrongg3
targetqblankqgflosportslaglstrongg verticalslpglulglligla3
verticalslpglulglligla hrefqhttpwwwmilesplitcomq3
hrefqhttpwwwmilesplitcomq targetqblankqgmilesplitlaglliglligla3
targetqblankqgmilesplitlaglliglligla hrefqhttpwwwflowrestlingcomq3
hrefqhttpwwwflowrestlingcomq targetqblankqgflowrestlinglaglliglligla3
hrefqhttpwwwfloelitecomq targetqblankqgfloelitelaglliglligla3
hrefqhttpwwwvarsitytvq targetqblankqgvarsitytvlaglliglligla3
targetqblankqgfloelitelaglliglligla hrefqhttpwwwflotrackorgq3
hrefqhttpwwwflotrackorgq targetqblankqgflotracklaglliglligla3
targetqblankqgflotracklaglliglligla hrefqhttpwwwflograpplingcomq3
hrefqhttpwwwflograpplingcomq targetqblankqgflograpplinglaglliglligla3
targetqblankqgflograpplinglaglliglligla hrefqhttpwwwflocombatcomq3
hrefqhttpwwwflocombatcomq targetqblankqgflocombatlaglliglligla3
targetqblankqgflocombatlaglliglligla hrefqhttpwwwflovolleyballcomq3
hrefqhttpwwwflovolleyballcomq targetqblankqgflovolleyballlaglliglligla3
targetqblankqgflovolleyballlaglliglligla hrefqhttpwwwflocheercomq3
hrefqhttpwwwflocheercomq targetqblankqgflocheerlaglliglligla3
targetqblankqgflocheerlaglliglligla hrefqhttpwwwvarsitytvq3
competitive athletes3
gymnastics133
cbd51
ahellip51
news48
events38
you36
your34
team33
noreferrerq31
relqnoopener31
all30
videos29
national28
competitions27
mary27
their26
club26
but26
aamp26
athletes26
can25
not24
sports24
state24
live24
level24
has24
more23
have23
elite23
flosports22
our22
we21
us20
019
william19
school18
teams18
menarsquos17
articles17
flogymnasticscom17
stream17
andash17
they16
cut16
rutgers16
many16
like16
116
being15
two15
college15
because15
products15
rx13
213
programs13
collegiate13
training13
career13
help12
also12
ncaa12
honor11
community11
data-feathr-click-trackqtrueq11
regional11
make11
coaches11
through10
floor10
athletic10
challenge10
get10
announces10
program10
access10
310
which10
save10
freshmen10
ngcontent-c7qq10
classqfa9
were9
aria-hiddenqtrueq9
across9
no9
just9
watch9
if9
pain9
latest9
society9
jo9
often9
only8
48
qualifier8
year8
her8
towards8
time8
alumni8
all-around8
there8
beam8
pro8
flogymnastics8
body8
high8
experience8
so8
58
muscle8
together8
68
sport8
routines7
fans7
data-aosqq7
after7
data-aos-offsetq100q7
77
sleep7
athlete7
oct7
gaba7
chose7
recovery7
womenss7
stress7
inflammation7
hslstrongglpglpglstronggnoteslstrongg7
its7
shared7
do7
even7
academic7
these7
gymnast7
champion7
before7
see6
announced6
newcomers6
now6
tribe6
benefits6
three6
tv6
sites6
board6
however6
dirqltrq6
new6
support6
addition6
bodyqqdisplaynameqnullqslugqqgoverning-bodyqqparentqnullqcreatedatqq2019-08-13t1625510000qqmodifiedatqq2020-04-29t0402110000qqcreatedatqq2019-10-22t1651510000qqmodifiedatqq2020-04-29t0402360000qqsluguriqqcollectionstagartisticqqidq40456qnameqqartisticqqdisplaynameqnullqslugqqartisticqqparentqqsluguriqqcollectionstagevent-typeqqidq38918qnameqqevent6
86
graduated6
include6
any6
brothers6
family6
bars6
first6
decision6
athletics6
academy6
siblings6
list6
parents6
than6
squadron6
some6
waampm6
womenarsquos6
vault6
join6
force6
fa-chevron-right6
member6
coach6
ngcontent-c5qq6
know6
current6
gymnasts6
hitqqx-cache-hitsqq06
96
ngcontent-c7qqgli6
needs6
105
need5
found5
honors5
115
senior5
international5
nickname5
both5
fillqcurrentcolorq5
riley5
day5
up5
nj5
replay5
125
science5
cutting5
since5
major5
call5
could5
campus5
love5
competitive5
little5
six5
styleqtext-align5
ready5
fr-draggableq5
one5
plans5
135
department5
years5
donate5
financial5
use5
over5
content5
grand5
sister5
amount5
viewboxq05
been5
oxidative5
right5
place5
free5
terpenes5
z5
may5
lstronggcbd5
most5
nsaids5
antioxidant4
cuts4
directly4
then4
true4
documentaries4
involved4
publishedqqstatuscolorqqcdeb8bqqpremiumqfalseqnodeqqcategoriesqqsluguriqqcollectionstagnewsqqidq15qnameqqnewsqqdisplaynameqnullqslugqqnewsqqparentqqsluguriqqcollectionstagcontent-typeqqidq1qnameqqcontent4
email4
top4
dirqltrqgwilliam4
event4
144
womena39s4
write4
available4
does4
ca4
university4
effective4
thatarsquos4
between4
olympics4
engineering4
workout4
still4
student4
other4
my4
way4
drill4
visitors4
didnarsquot4
called4
savewmgym4
dona39t4
well4
ability4
used4
scarlet4
companies4
potential4
consider4
therapeutic4
154
big4
youa39re4
radicals4
newest4
means4
cga4
classqfroala-imageq4
johanek4
petition4
targetqblankqgemail4
show4
able4
lead4
minor4
invite4
conversation4
ross4
routine4
beyond4
tenqqdisplaynameqnullqslugqqbig-tenqqparentqqsluguriqqcollectionstagconferenceqqidq38919qnameqqconferenceqqdisplaynameqnullqslugqqconferenceqqparentqnullqcreatedatqq2019-08-13t1626090000qqmodifiedatqq2020-04-29t0402110000qqcreatedatqq2019-10-22t1651500000qqmodifiedatqq2020-04-29t0402170000qqsluguriqqcollectionstagncaaqqidq40455qnameqqncaaqqdisplaynameqnullqslugqqncaaqqparentqqsluguriqqcollectionstaggoverning-bodyqqidq38917qnameqqgoverning4
academics4
health4
societyahellipdaughter4
great4
studies4
award4
amp4
beautiful4
bar4
emily4
stronger4
lee4
164
gain4
season4
waldman4
everyone4
had4
metroplex4
out4
junior4
cannabinoids4
county4
highlights4
really4
class4
exclusive4
effects3
world-class3
partnered3
benefit3
producer3
roll3
grapple3
energy3
association3
amazing3
hard3
regarding3
hs3
camden3
acro3
prohibited3
felt3
knights3
physical3
scholar3
impact3
florida3
ways3
compete3
world3
eliminated3
very3
people3
removed3
something3
night3
put3
val3
continue3
using3
partners3
getting3
balance3
jordan3
featuring3
product3
safe3
targetqblankqgdonate3
company3
regionals3
friends3
hobbies3
difference3
variety3
research3
produced3
those3
kasamatsu3
sisters3
head3
result3
campaign3
country3
intense3
pressure3
them3
nichols3
sunisa3
perfect3
workouts3
anxiety3
rips3
salim-beasley3
practice3
roster3
tape3
173
wrist3
conditioning3
ucla3
although3
breathe3
sure3
hrefqhttpwwwflohoopscomq3
hrefqhttpswwwflosoftballcomq3
hrefqhttpswwwfloswimmingcomqgfloswimminglaglliglligla3
targetqblankqgflomarchinglaglliglligla3
hrefqhttpwwwflomarchingcomq3
targetqblankqgflorodeolaglliglligla3
hrefqhttpwwwflorodeocomq3
targetqblankqgflohoopslaglliglligla3
targetqblankqgvarsitytvlaglliglligla3
hrefqhttpswwwflohockeytvqgflohockeylaglliglligla3
hrefqhttpwwwvarsitytvq3
targetqblankqgflocheerlaglliglligla3
hrefqhttpwwwflocheercomq3
targetqblankqgflovolleyballlaglliglligla3
hrefqhttpwwwflovolleyballcomq3
targetqblankqgflocombatlaglliglligla3
hrefqhttpwwwflocombatcomq3
idqidgpn296qgflosoftballlaglliglligla3
hrefqhttpswwwfloracingcomqgfloracinglaglliglligla3
hrefqhttpwwwflograpplingcomq3
premium3
roku3
appsanbsplstronggnow3
data-redactor-tagqstrongqgdownload3
watchlh2glpglstrong3
abovelpglhrglh2ghow3
listed3
183
subscription3
hrefqhttpswwwflovoicecomqgflovoicelaglliglligla3
annual3
hrefqhttpswwwflosportstvcaaqgcaalaglliglulglpgwith3
hrefqhttpswwwflofccomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofclaglliglligla3
hrefqhttpswwwflobowlingcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflobowlinglaglliglligla3
hrefqhttpswwwflofootballcomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflofootballlaglliglligla3
hrefqhttpswwwflobikescomqgflobikeslaglliglligla3
hrefqhttpswwwflodancecomutmsourceflosportshomepageautmmediumreferralautmcampaignflosportstvautmtermournetworkqgflodancelaglliglligla3
hrefqhttpswwwflorugbycomqgflorugbylaglliglligla3
targetqblankqgflograpplinglaglliglligla3
targetqblankqgflotracklaglliglligla3
193
hrefqhttpswwwflogymnasticscomeventsqgwatchlag3
techniques3
hrefqhttpswwwflogymnasticscomtrainingqgdiscoverlag3
rankings3
yourself3
hrefqhttpswwwflogymnasticscomrankingsqgimmerselag3
on-demandanbsplpglpgla3
favorite3
deserveanbsplpglpgla3
hrefqhttpswwwflogymnasticscomfilmsqgenjoylag3
appqqshorttitleqqget3
appqqseodescriptionqqget3
appqqauthorqqprofilepictureurlsmallqqhttpsrescloudinarycomdiznifolnimageuploadw100h100pkhnsfwnt0p408py1nrxpngqqprofilepictureurlmediumqqhttpsrescloudinarycomdiznifolnimageuploadw125h125pkhnsfwnt0p408py1nrxpngqqprofilepictureurllargeqqhttpsrescloudinarycomdiznifolnimageuploadw150h150pkhnsfwnt0p408py1nrxpngqqcompanymigratedfromqnullqidq2085223qusernameqqchezsieversqqfirstnameqqchezqqlastnameqqsieversqqgenderqqfqqcreatedatqq2015-10-19t2057450000qqmodifiedatqq2020-07-02t1928580000qqassetqqidq7097591qtitleqqget3
appqqdescriptionqnullqcreditqnullqsourceqqhttpsdamb2tknfsommcloudfrontnetuploadedlqbzdlmbk0kglzzmjzqg9donye9jneqwimages00001jpgqqsiteqqdomainqqwwwflogymnasticscomqqidq4qnameqqflogymnasticsqqcodeqqflogymnasticsqqhostqqhttpswwwflogymnasticscomqqactiveqtrueqtypeqqsiteqqversionq3qcolorqqff140fqqheroimageqqhttpsd6fm3yzmawlcscloudfrontnetmobileverticalbackgroundmobilebgflogymnasticsjpgqqmodifiedatqnullqshowonmobileqtrueqsportnameqqgymnasticsqqurlqqhttpsd2779tscntxxswcloudfrontnetlqbzdlmbk0kglzzmjzqg9donye9jneqwjpgqqlibraryqfalseqstatuscodeqnullqpathqnullqcopiedqfalseqduplicatedqfalseqcreatedatqq2020-09-29t1621590000qqmodifiedatqnullqlogoqnullqslugqqget-the-flosports-appqqpublishstartdateqq2020-09-29t1620000000qqpublishenddateqnullqstatusq1qstatustextqqactive3
bodyqqdisplaynameqnullqslugqqgoverning-bodyqqparentqnullqcreatedatqq2019-08-13t1625510000qqmodifiedatqq2020-04-29t0402110000qqdescriptionqqlpgif3
giving3
passionate3
library3
521-2343
hrefqhttpwwwflotrackorgq3
targetqblankqgflosportslaglstrongg3
targetqblankqgfloelitelaglliglligla3
hrefqhttpwwwfloelitecomq3
targetqblankqgflowrestlinglaglliglligla3
hrefqhttpwwwflowrestlingcomq3
targetqblankqgmilesplitlaglliglligla3
hrefqhttpwwwmilesplitcomq3
verticalslpglulglligla3
hrefqhttpwwwflosportstvq3
beloved3
data-verifiedqredactorqgla3
data-redactor-tagqstrongq3
lstrong3
0-5213
234-5213
therelpglpgyou3
softballanbsplpglpgbe3
players3
amazon3
apple3
came3
much3
autoq3
height3
203
styleqwidth3
sign3
gaby3
things3
good3
never3
feel3
claims3
pandemic3
prior3
small3
division3
varsity3
classqfr-fic3
social3
function3
isnarsquot3
tough3
ita39s3
far3
week3
hours3
go3
marsh3
laura3
media3
comes3
gym3
helps3
diversity3
facilities3
open3
letter3
simply3
reason3
affect3
ios3
213
idqidgpn613q3
hrefqhttpswwwfacebookcomflogymnasticsq3
targetqblankqgflogymnasticslaglpglpglike3
idqidgpn560q3
hrefqhttpswwwinstagramcomflogymnasticsq3
instagram3
targetqblankqgflogymnasticslaglpglpgfollow3
223
lpath3
idqidgpn470q3
hrefqhttpstwittercomflogymnasticsq3
twitter3
sociallh2glpgfollow3
herelaglpglhrglh2gjoin3
hrefqhttpswwwflogymnasticscomsignupqgsign3
data-redactor-tagqstrongqgstreaminganbsplstronggpro3
androidlpglpglstrong3
targetqblankqgfacebooklaglpgqqdescriptionplainqqget3
500q3
track3
pushing3
less3
losing3
though3
alaska3
classqcol-md-43
primary-color-bgqgliglh43
back3
months3
233
meets3
multiple3
disappointing3
243
xmlnsqhttpwwww3org2000svgq3
253
previous3
returners3
ingredients3

Who hosts Gymnastike.org?

Gymnastike.org Hosting Provider Information

Hosted IP Address:151.101.66.114
Hosted Hostname:151.101.66.114
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Consortium GARR
0.1277%

HTTP Header Analysis for Gymnastike.org

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Retry-After: 0
Location: https://www.gymnastike.org/
Content-Length: 0
Accept-Ranges: bytes
Date: Sun, 11 Oct 2020 22:48:48 GMT
Connection: close
X-Served-By: cache-lcy19221-LCY
X-Cache: HIT
X-Cache-Hits: 0
X-Timer: S1602456528.427824,VS0,VE0
access-control-allow-credentials: true
access-control-allow-methods: GET,HEAD,OPTIONS,PATCH,PUT,POST,DELETE
access-control-allow-headers: Range,Expires,Etag,Cache-Control,Content-Length,Content-Type,Content-Range,Authorization,DNT,X-301-Location,Keep-Alive,User-Agent,X-Requested-With,If-Modified-Since,x-flo-flags,x-flo-flags-all
access-control-expose-headers: Range,Expires,Etag,Cache-Control,Content-Length,Content-Type,Content-Range,Last-Modified,Pragma,x-flo-flags,x-flo-flags-all
access-control-max-age: 86400
Vary: Origin
Strict-Transport-Security: max-age=900
x-flo-info-state: HIT-SYNTH-cache-lcy19221-LCY

Gymnastike.org Domain Nameserver Information

HostIP AddressCountry
ns-1412.awsdns-48.org 205.251.197.132
ns-97.awsdns-12.com 205.251.192.97
ns-1752.awsdns-27.co.uk 205.251.198.216
ns-774.awsdns-32.net 205.251.195.6


Need to find out who hosts Gymnastike.org?


Domain Registration (WhoIs) information for Gymnastike.org

 Domain Name: GYMNASTIKE.ORG
Registry Domain ID: D153370016-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-07-17T17:13:22Z
Creation Date: 2008-07-16T17:08:10Z
Registry Expiry Date: 2021-07-16T17:08:10Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS-1412.AWSDNS-48.ORG
Name Server: NS-97.AWSDNS-12.COM
Name Server: NS-1752.AWSDNS-27.CO.UK
Name Server: NS-774.AWSDNS-32.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-13T07:34:00Z

Websites with Similar Names

Gymnachod.cz
Jiráskovo gymnázium Náchod
Gymnacity.info
gymnacity | Fitness
Gymnacity.us
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Gymnacityshop.com
GYMNACITY SHOP
Gymnadeniacrown.xyz
400 Bad Request
Gymnado.com
423 Locked
Gymnaestrada.fi
Gymnaestrada Tampere 2022
Gymnaestrada.org
gymnaestrada.org - For Sale!
Gymnagano.com
ホーム - 長野パーソナルジム・フィットネス・トレーニング【公式】竹下製肉所
Gymnamic.org
Gymnamic – Club de gymnastique

Recently Updated Websites

Ptoventures.com (4 seconds ago.)Jessicachristopherdesigns.com (14 seconds ago.)Beyondsalesfunnels.com (15 seconds ago.)Taorminataxisharing.it (16 seconds ago.)Nintrix.com (17 seconds ago.)Rayhanakapadia.com (18 seconds ago.)Easywall.com (21 seconds ago.)Travellingbarista.com (24 seconds ago.)Thebucherteam.com (25 seconds ago.)Phillipsrealty-group.com (31 seconds ago.)Skijoering.com (33 seconds ago.)Charity1concepts.info (34 seconds ago.)Namdarelectric.com (35 seconds ago.)Draincleaningservicetoday.com (36 seconds ago.)Meditativechristians.com (37 seconds ago.)Ingpoistovna.sk (38 seconds ago.)Luxurystore88.com (39 seconds ago.)Anthonyjay.com (41 seconds ago.)Tribesofchrist.com (47 seconds ago.)Hnszcjz.com (48 seconds ago.)Kreonfinancial.com (49 seconds ago.)Electronicvisabrazil.com (50 seconds ago.)Mikekrukowski.com (51 seconds ago.)Projectupland.xyz (52 seconds ago.)Riveinvest.com (55 seconds ago.)Creativehealinginfo.com (56 seconds ago.)Creditbender.com (58 seconds ago.)Cluby.info (58 seconds ago.)Pontemusica.com (59 seconds ago.)Cottywendys.com (1 minute 1 second ago.)

Recently Searched Keywords

000 000 sale (1 second ago.)bài viết (6 seconds ago.)supply lists (7 seconds ago.)the domain hangmymirrow.info may be for sale by its owner! (12 seconds ago.)masthead (13 seconds ago.)bio-netmov bio-netmov (18 seconds ago.)old ironsides fakes reddit (20 seconds ago.)official blog (20 seconds ago.)your resistance (22 seconds ago.)1130 lovers in paradise (connie) (22 seconds ago.)follow kim on instagram (23 seconds ago.)不銹鋼罐 (28 seconds ago.)2020october 29 2020 (29 seconds ago.)249 1background-colorrgba159 140 (30 seconds ago.)county recorder (48 seconds ago.)bobs furniture sectional with ottoman (53 seconds ago.)66 66 06comp-kchjekfz (56 seconds ago.)17. februar 201811. märz 2018 (1 minute 2 seconds ago.)kross gear cycle under 7000 (1 minute 12 seconds ago.)biżuteria sztuczna (1 minute 20 seconds ago.)pensacola news (1 minute 25 seconds ago.)style-jcuyjv3oactivestyle-jcuyjv3oitemstyle-jcuyjv3odark style-jcuyjv3olink (1 minute 45 seconds ago.)fondo turapori per esterno ad acqua (1 minute 48 seconds ago.)fachtagung freie werkst (1 minute 49 seconds ago.)goodtranslation (1 minute 52 seconds ago.)registration letter (1 minute 54 seconds ago.)mehndi designs (1 minute 55 seconds ago.)geriatricsolutionstampa (2 minutes ago.)oleeh arabic (2 minutes 2 seconds ago.)registration renewal dubai (2 minutes 3 seconds ago.)