Happy Tails Dog Training Center | Rapid City, SD | Obedience Classes, Etc.

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Looking for professional, specialty dog training in the Black hills area? Look no further! Happy Tails Dog Training in Rapid City has a great list of classes including basic and advanced obedience, agility, nose work, and rally.

Useful Searches

happy tails dog training

,


Domain summary

Last updated
2021-04-15
Domain label
happytailsdogtraining
Domain extension
biz
Domain registered:
2000-01-29
Domain updated:
2021-04-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is happytailsdogtraining.biz ranked relative to other sites:

Percentage of visits to happytailsdogtraining.biz from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Happytailsdogtraining.biz registered?
A: Happytailsdogtraining.biz was registered 21 years, 3 months, 2 weeks, 3 days, 14 hours, 16 minutes, 34 seconds ago on Saturday, January 29, 2000.
Q: When was the WHOIS for Happytailsdogtraining.biz last updated?
A: The WHOIS entry was last updated 1 month, 14 hours, 16 minutes, 34 seconds ago on Thursday, April 15, 2021.
Q: What are Happytailsdogtraining.biz's nameservers?
A: DNS for Happytailsdogtraining.biz is provided by the following nameservers:
  • ns9.wixdns.net
  • ns8.wixdns.net
Q: Who is the registrar for the Happytailsdogtraining.biz domain?
A: The domain has been registered at NEULEVEL.
Q: What is the traffic rank for Happytailsdogtraining.biz?
A: Happytailsdogtraining.biz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Happytailsdogtraining.biz each day?
A: Happytailsdogtraining.biz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Happytailsdogtraining.biz resolve to?
A: Happytailsdogtraining.biz resolves to the IPv4 address 185.230.63.171.
Q: In what country are Happytailsdogtraining.biz servers located in?
A: Happytailsdogtraining.biz has servers located in the United States.
Q: What webserver software does Happytailsdogtraining.biz use?
A: Happytailsdogtraining.biz is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Happytailsdogtraining.biz?
A: Happytailsdogtraining.biz is hosted by Fara Negar Pardaz Khuzestan in Virginia, Ashburn, United States, 20147.
Q: How much is Happytailsdogtraining.biz worth?
A: Happytailsdogtraining.biz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Happytailsdogtraining.biz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Happytailsdogtraining.biz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Happytailsdogtraining.biz

H1 Headings

4 :
  1. HAPPY TAILS DOG 
  2. TRAINING
  3. CENTER
  4. Click Here for Upcoming Classes

H2 Headings

7 :
  1. Scroll Down.
  2. Our Philosophy
  3. What People Are Saying About Us.
  4. Our Facility
  5.  Please send us a message or give us a call.
  6. We can't wait to help you and your dog.

H3 Headings

1 :
  1. CONTACT US

H4 Headings

6 :
  1. Kelli F.
  2. Stormy L.
  3. John G.
  4. Shelby M.
  5. Jill D.
  6. Barton T.

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Happytailsdogtraining.biz

galleryitemgalleryitemvideo100px 6px 0pxwebkittaphighlightcolorrgba0 0 0solid rgba0 0spinnakersansseriftextdecoration compk6tlvb7dvery163 30 1inotprogallerylovedcompk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemhoverdefaultforcehoverbeforecompk6tlvb7darea provides5font normal normalcontrolled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleour249 1backgroundcolorrgba255 255dogs0 0rapid city sdtopautobottom0profullscreenwrappergalleryitemhoverdefaultforcehoverbeforecompk6tlvb7d progalleryinlinestylesinfoelementcustombuttonwrapper980pxfontnormal normal normal15px14em spinnakersansserifitemdescriptionfontcolorslideshowsafe placecangalleryitemwrapper galleryslideshowinfo svgfff stroke ffffullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavtruetransitioncolortraininggoodimportantleftauto importantzindex50050fontnormal normalinfoelementdescriptioncompk6tlvb7d progalleryinlinestyles galleryitemcontainerartbasic and advancedupstylekhwbxd24navcontainerrightdirectionhappyinfoelementtitlecompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorbuttoncompk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyleslistffffffcolorrgb255importantfontnormalfurther happy tails255 255 1borderwidth1pxfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarstylekhwbxd24navcontainerarrowgreat list000000colorrgba00px rgba00006antonsansserifitemfontcolorslideshow0fontnormal06 importantcompk6tlvb7dbuttoncompk6tlvb7d profullscreenwrapperplace for yougalleryitemcontainerprogallerymobileindicator galleryitemleftinfo18px14em13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleour255 1borderstylesolidbordercolorrgba2211controlled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fullyrallycity sd60x50 trainingprogalleryinlinestyles galleryitemcontainer galleryitemtopinfostrokeetcrgba54 149 151100pxcentercity hasnewtraining area providesgalleryslideshowinfo infoelementtitleitemfontslideshow normalcompk6tlvb7d15px14em spinnakersansserifitemdescriptionfontcolorslideshow 000000colorrgb0progalleryinlinestyles galleryitemcontainer galleryslideshowinfogalleryitemwrapper galleryitemhover svgterry79 79importantcompk6tlvb7d progalleryinlinestyles galleryitemcontainertransitioncolor 04s easegalleryitemcontainerprogallerymobileindicator galleryitembottominfonormal normal 40px50px60x501borderstylesolidbordercolorrgba221no255 1borderstylesolidbordercolorrgba139vectoreffectnonscalingstroke0 0 06stroke fff strokewidth22px27px avenirltw0185heavy1475544sansseriftextdecoration compk6tlvb7dffffffcolorrgb255 255normal 16px14emspinnakersansserifitemdescriptionfontcolorslideshow22px27px avenirltw0185heavy1475544sansseriftextdecorationnormal 14px14em spinnakersansseriftextdecoration8255 importantcompk6tlvb7d15px14emfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocial22px27pxstylekhwbxd24navcontainerborderwidth0normal 22px27px avenirltw0185heavy1475544sansseriftextdecorationnormal 15px14em spinnakersansserifitemdescriptionfontcolorslideshowspinnakersansseriftextdecoration compk6tlvb7d profullscreenwrapperspinnakersansserifitemdescriptionfontcolorslideshow 000000colorrgb0 0inotprogallerylovedcompk6tlvb7dgalleryitemwrapper galleryslideshowinfocontrolled06 0txtnew0 06 importantcompk6tlvb7ddoggalleryitemwrapper galleryitemhoverclassadvancedgreatnormal 15px18px avenirltw0135light1475496sansseriftextdecorationspecialtyinfoelementdescriptioncompk6tlvb7d progalleryinlinestylesdog training centernormal normal 15px14emprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrappervisitorstraining area fullysvg positionabsolutetop0right0bottom0left0width100height100marginautopositionabsolutetop0right0bottom0left0width100height100marginautotraining center14px14em spinnakersansseriftextdecorationstylekhwbxd24repeaterbuttonwrapperinfoelementtitlecompk6tlvb7d progalleryinlinestyles galleryitemcontainerobedience classesmarginleft calc100 980pxadvanced obedience agilityprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialnose workprogalleryinlinestylesn npositionfixed16px14em spinnakersansserifdog to learnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec212454be79b70e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aeeea944bd9a243522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aeeea944bd9a243522f68ad2b28idx2ingroupidx1dtoida2169aeeea944bd9a243522f68ad2b28width4272height2848itemida2169aeeea944bd9a243522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentrywayimportantcompk6tlvb7dgalleryitemcontainer galleryslideshowinfo1borderstylesolidbordercolorrgba139 139 139infoelementtitleitemfontslideshown n ngalleryitemcontainer galleryitembottominfonormallb1itemscontainer14px14em spinnakersansserif12249 1backgroundcolorrgba255custombuttonwrapper buttoncompk6tlvb7d255 importantcompk6tlvb7d progalleryinlinestylesgalleryitemwrapperstylekge0xeo7label13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fully matted04s255 255 1borderstylesolidbordercolorrgba139borderwidth0 backgroundcolorrgba255 255spinnakersansserifcolorrgb0n nninfosvgtypeshapeviewbox0stylekhwbxd24repeaterbuttonlabelrgba0 0 0our facebookclassestypemetapropsnamedescriptioncontentlooking for professionaltypemetapropsnamedescriptioncontentlookingease 0s stylekhwbxd24repeaterbuttondatastateoverantonsansserif color000000galleryslideshowinfogalleryitemhover svgnormal 22px27pxgalleryitembottominfoavenirltw0135light1475496sansseriftextdecoration compk6tlvb7d progalleryinlinestylesnninfosvgtypeshapeviewbox0 0fully matted0sgalleryitemcontainerprogallerymobileindicator galleryitemwrapperselectdataerrortrueborderstylesolidbordercolorrgba249 249acompk6tlvb7dsvgbuttoncompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorfurther happyhavemethodmargin0lineheightnormalletterspacingnormal txtnewmatted training area000000temperature controlled0 importantcompk6tlvb7d1borderstylesolidbordercolorrgba221 163 30compk6tlvb7d progalleryinlinestylesagility nose workusfill fffincluding149 151 1stylekge0xeo7labelwrapperbackgroundcolorrgba255 255 255area fullyspinnakersansserif249 249 1backgroundcolorrgba255compk6tlvb7d profullscreenwrapper7galleryitemcontainerprogallerymobileindicator galleryitemtopinfogalleryitemhoverbeforeitemopacity 000000backgroundrgba0compk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesobediencecalc1001backgroundcolorrgba255 255 255profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial4ft facilitygalleryitemrightinfofillborderwidth2pxstrokewidth 0infoelementtitleitemfontslideshow normal255 1borderstylesolidbordercolorrgba221 163normal normal 16px14em255 255borderwidth2px borderstylesolidbordercolorrgba249importantzindex50antonsansserifitemfontcolorslideshow 000000colorrgb0 0advanced obediencepositionabsolutetop0right0bottom0left0progalleryinlinestyles galleryitemcontainer galleryitembottominfogalleryitemhoverbeforeitemopacity 000000backgroundrgba0 0normal normal 22px27pxgalleryitemcontainerprogallerymobileindicator galleryslideshowinfomarginleft calc100area fully mattedfacility with 60x50has a greatprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebargalleryitemcontainer galleryitemwrapperbuttoncompk6tlvb7d progalleryinlinestyles galleryitemcontainerstrc1dataresponsivesolid6selectdatapreviewfocusavenirltw0135light1475496sansseriftextdecorationbuttoncompk6tlvb7d progalleryinlinestylestemperature255compk6tlvb7d profullscreenwrapper1 stylekhwbxd24navcontainergalleryitemhover255compk6tlvb7dbackgroundcolorrgba54progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemrightinfolist of classes0compk6tlvb7dmytakenincluding basicobject151 1normal 15px14emdivprogalleryparentcontainergalleryitemtitlecompk6tlvb7d progalleryinlinestyles galleryitemcontainerrapidyour payment method0 0compk6tlvb7dpositive22px14em000000backgroundrgba0 0nninfosvgtypeshapeviewbox0wefffstylekhwbxd24repeaterbuttondatastateselected0 06 0profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfospecialty dog trainingbackgroundcolorrgba54 149selectdatapreviewerrornormal normal normal1backgroundcolorrgba255hasimportantgalleryitemcontainerwork and rallyimportantcompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorborderradius0yougalleryslideshowinfo infoelementtitleitemfontslideshowcenter rapid citygalleryitemtitlecompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatormatted floorprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemleftinfo205s ease1backgroundcolorrgba255 255strc1inlinecontentstylekhwbxd24navcontainerarrowstylekhwbxd24navcontainerleftdirectionpaymentn n nninfosvgtypeshapeviewbox013selectdatapreviewhoverprogalleryinlinestyles galleryitemcontainer galleryitemrightinfogalleryslideshowinfo svgeaseacompk6tlvb7d profullscreenwrapperfullscreensidebarsocial0 0 0importantcompk6tlvb7d progalleryinlinestylesstylekg8jh7orbggalleryslideshowinfo galleryitemdescriptioncompk6tlvb7d progalleryinlinestylesfurther60x50 training areafully matted floorsq ftbackgroundcolorrgba54 149 151textalignleft14look nobuttoncompk6tlvb7dfff strokewidthhillsno furtherspinnakersansseriftextdecoration04s easeclasses including basicyourstylekhwbx5gkbgnormal 25px14embuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompk6tlvb7d progalleryinlinestylesifpositionfixed importantleftautocenter rapidfloorborderwidth1px backgroundcolorrgba255 255noseagility nose3acompk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles255 255compk6tlvb7d profullscreenwrapperclasses etcrgba0139 139 1stylekhwbxd24navcontainersvgcontainerultxtnew olstorenormal normal0compk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles204 204249 249galleryitemcontainer galleryitemtopinfo05sprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavpositionfixed importantleftauto importantzindex501px000000colorrgb0 00compk6tlvb7d profullscreenwrappertraining center rapidprofessional specialtyulinotprogallerylovedcompk6tlvb7d profullscreenwrapperspinnakersansserifitemdescriptionfontcolorslideshow 000000colorrgb0stylekhwbxd24repeaterbuttonborderwrapperfontgalleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompk6tlvb7d progalleryinlinestylesrapid city hasbackgroundcolorrgba255 255sd obediencenormal 14px14em spinnakersansserif11rgba546pxborderwidth0 backgroundcolorrgba255galleryitemdescriptioncompk6tlvb7d progalleryinlinestylessolid rgba0look5000 sq ft1borderstylesolidbordercolorrgba139galleryitemcontainer galleryitemrightinfoinfoelementtitlecompk6tlvb7d0 0 importantcompk6tlvb7d30 1avenirltw0135light1475496sansseriftextdecoration compk6tlvb7dinfoelementdescriptioncompk6tlvb7d9progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfoetc typemetapropsnamedescriptioncontentlookingrgba00006avenirltw0185heavy1475544sansseriftextdecoration compk6tlvb7dnormal normal 25px14emfullscreensocialareagetgalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfoup yourfloor handicap accessiblestylekhwbxd24navcontainercenterdirection15px18px avenirltw0135light1475496sansseriftextdecoration compk6tlvb7ddog trainingantonsansserifitemfontcolorslideshow 000000colorrgb0nprofessional specialty dogarea look nolearnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec212454be79b70e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aeeea944bd9a243522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aeeea944bd9a243522f68ad2b28idx2ingroupidx1dtoida2169aeeea944bd9a243522f68ad2b28width4272height2848itemida2169aeeea944bd9a243522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentryway welcome10look no furtherprogalleryinlinestyles galleryitemcontainerhappy tails dogb0b0b0normal normal 18px14emcolor000000stylekge0xenttextareargba54 149ultxtnewavenirltw0185heavy1475544sansseriftextdecoration compk6tlvb7d progalleryinlinestyles000000backgroundrgba0 0 0backgroundcolor ffffffworkgalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhovergalleryitemdescriptioncompk6tlvb7dblack hills139 139sd obedience classestextaligncenter000000colorrgb0255 255 importantcompk6tlvb7dsd0 2000s stylekhwbxd24repeaterbuttondatastateovergalleryitemcontainerprogallerymobileindicatorourstrokewidthboxshadownoneftcolor ffffffolimportantleftauto000000colorrgb0 0 0txtnew ulprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatorffffffcolorrgb255 255 255compk6tlvb7dcalc100 980pxfullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryslideshowinfo galleryitemtitlecompk6tlvb7dprovides a safeimportantfontnormal normal163 30139 1custombuttonwrapper buttoncompk6tlvb7d progalleryinlinestyles000000backgroundrgba0stylekhwbxd24navcontainerarrowstylekhwbxd24navcontainercenterdirectionstylekhwbxd24repeaterbuttondatastateoverinfoelementcustombuttonwrapper buttoncompk6tlvb7d progalleryinlinestyles000000colorrgba0 0 0training in rapidtailsfullyobedience agility nosegalleryitemdescriptioncompk6tlvb7d progalleryinlinestyles galleryitemcontainerbuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompk6tlvb7d255 255compk6tlvb7d13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fullybackgroundcolorstylekhwbxd24navcontainerarrowstylekhwbxd24navcontainerrightdirectionfff strokefacilityinotprogallerylovednotinfoelementlovedcompk6tlvb7d progalleryinlinestylesno further happy100px 6pxagilityborderradius80pxborderwidth2px borderstylesolidbordercolorrgba249 249progalleryinlinestyles galleryitemcontainer galleryitemwrapperfontnormal normalwantstroke fff255compk6tlvb7d profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylessvg overflowvisibleaccessiblebackgroundcolorrgba255learnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec212454be79b70e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aeeea944bd9a243522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aeeea944bd9a243522f68ad2b28idx2ingroupidx1dtoida2169aeeea944bd9a243522f68ad2b28width4272height2848itemida2169aeeea944bd9a243522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentrywayimportantfontnormal normal normalcustombuttonwrapperstylekhwbxd24navcontainerarrow stylekhwbxd24navcontainersvgcontainersq ft facilitycompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorobedience agilityfully matted trainingprogalleryinlinestyles galleryitemcontainer galleryitemleftinfocontactsafegalleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompk6tlvb7dcity sd obediencegalleryitemcontainer galleryitemleftinfofullscreenmobilebargalleryitemcontainerprogallerymobileindicator galleryitemrightinfool ulmatted trainingavenirltw0185heavy1475544sansseriftextdecoration0spinnakersansserifcolorrgb0 0selecthovernormal 15px18pxhills area lookinfoelementtitlecompk6tlvb7d progalleryinlinestylescityinfoelementtitleitemfontslideshow normal normalwelcome to happyease 0smattedobedience classes etcprovideswebkittaphighlightcolorrgba0stylekge0xeo7linkup your paymentgalleryitemleftinfo149 15116px14emnormal 14px14emwelcome255 1 stylekhwbxd24navcontainer6px 0pxtraining areaffffff255 255 1borderstylesolidbordercolorrgba2215000 sqcontentstylekge0xen0input04s ease 0sfill fff strokemargin0lineheightnormalletterspacingnormalwebkittaphighlightcolorrgba0 0marginleft05s ease 0sclickselectdatapreviewerror stylekhwbxd24navcontainerarrowblack hills areagalleryslideshowinfo galleryitemdescriptioncompk6tlvb7dspinnakersansserif color4f4f4fcalc100 980px 05basicyour paymentinfoelementcustombuttonwrapper buttoncompk6tlvb7dinfoelementdescriptioncompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgalleryitemcontainer galleryitemwrapper galleryitemhovergalleryitemtitlecompk6tlvb7d progalleryinlinestylesinotprogallerylovednotinfoelementlovedcompk6tlvb7dleft10pxright10pxoverflowvisible255 1onlinetemperature controlled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b122c0145838d5b385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e56ca4081b70a8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e56ca4081b70a8dc828983186idx1ingroupidx1dtoida342868e56ca4081b70a8dc828983186width4272height2848itemida342868e56ca4081b70a8dc828983186issecurefalseorderindex1563814684155375metadatatitleourmoregalleryitemtopinfoborderstylesolidbordercolorrgba24906font normalnormal 18px14emborderwidth1px backgroundcolorrgba255galleryitemtextnormal normal 15px18pxyour dog0 0compk6tlvb7d profullscreenwrapperspecialty dognormal 40px50pxnninfosvgtypeshapeviewbox0 0 20015able0 importantfontnormal normal6px 0px rgba000060fontnormal normal normal14px14emgalleryitemhoverdefaultnothidehoverbeforebackground00000015px18px avenirltw0135light1475496sansseriftextdecoration25px14emfacebookoldirrtlaccessible and temperature15px18px06 importantcompk6tlvb7d progalleryinlinestylesgalleryitemhoverbeforeitemopacityclasses includingfontnormalgalleryitemdescriptioncompk6tlvb7d progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorcolor4f4f4farea lookstylekhwbxd24repeaterbuttondatastatedrop0pxnormal normal 14px14emtransitioncolor 04s0 importantfontnormal0 0 importantfontnormalcompk6tlvb7d progalleryinlinestyles galleryitemcontaineryou and yourprofessional255 1borderstylesolidbordercolorrgba139 139colorpayment methodstylekhwbxd24navcontainerleftdirectiongalleryitemcontainer galleryitemwrapper galleryslideshowinfo1borderstylesolidbordercolorrgba139 1390 0fontnormalclasses etc typemetapropsnamedescriptioncontentlookinggalleryitemwrapper galleryitemgalleryitemvideo1borderstylesolidbordercolorrgba221 163n nninfosvgtypeshapeviewbox0 0rgba0 0floor handicapantonsansserif980px 05handicap accessiblehappy tailstails dog trainingfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial0 0fontnormal normal0 importantcompk6tlvb7d progalleryinlinestylesblackhills areagalleryitemtitlecompk6tlvb7dnormal 16px14em spinnakersansserifvarrapid cityborderstylesolidbordercolorrgba249 249 249galleryslideshowinfo galleryitemtitlecompk6tlvb7d progalleryinlinestylestails dogsqplacehandicapfff strokewidth 0fullscreennavprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfo40px50px0 06selectfocus000000colorrgba0 0matted floor handicap

Longtail Keyword Density for Happytailsdogtraining.biz

KeywordsOccurences
normal normal normal32
calc100 980px 0531
margin-left calc100 980px31
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
n n n27
normal normal 14px14em26
tails dog training16
background-colorrgba255 255 25515
happy tails dog15
gallery-item-container gallery-item-wrapper gallery-item-hover14
custom-button-wrapper buttoncomp-k6tlvb7d pro-galleryinline-styles14
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
importantfontnormal normal normal13
buttoncomp-k6tlvb7d pro-galleryinline-styles gallery-item-container12
buttoncomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator12
font normal normal11
rgba0 0 011
0 0 0611
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
04s ease 0s10
info-element-custom-button-wrapper buttoncomp-k6tlvb7d pro-galleryinline-styles10
importantcomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
0 importantfontnormal normal9
normal normal 15px18px9
0 0 importantfontnormal9
fontnormal normal normal9
normal 14px14em spinnakersans-serif8
139 139 18
dog training center8
normal 14px14em spinnakersans-seriftext-decoration8
has a great7
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-k6tlvb7d pro-galleryinline-styles7
rapid city has7
normal 15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
training in rapid7
further happy tails7
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration comp-k6tlvb7d7
center rapid city7
comp-k6tlvb7d pro-galleryinline-styles gallery-item-container7
no further happy7
professional specialty dog7
importantcomp-k6tlvb7d pro-galleryinline-styles gallery-item-container7
gallery-item-titlecomp-k6tlvb7d pro-galleryinline-styles gallery-item-container7
gallery-item-descriptioncomp-k6tlvb7d pro-galleryinline-styles gallery-item-container7
look no further7
area look no7
hills area look7
black hills area7
gallery-item-titlecomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
gallery-item-descriptioncomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
specialty dog training7
you and your7
000000colorrgb0 0 07
training center rapid7
normal normal 15px14em7
1border-stylesolidborder-colorrgba139 139 1396
0 06 importantcomp-k6tlvb7d6
06 importantcomp-k6tlvb7d pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
0fontnormal normal normal6
pro-galleryinline-styles gallery-item-container gallery-item-right-info6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
welcome to happy6
comp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator6
255 1border-stylesolidborder-colorrgba139 1396
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-k6tlvb7d pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
255 255 1border-stylesolidborder-colorrgba1396
rapid city sd6
border-width0 background-colorrgba255 2556
normal normal 25px14em6
place for you6
pro-galleryinline-styles gallery-item-container gallery-item-left-info6
fully matted floor6
training area fully6
60x50 training area6
matted floor handicap6
floor handicap accessible6
facility with 60x506
sq ft facility6
accessible and temperature6
fully matted training6
matted training area6
training area provides6
area fully matted6
5000 sq ft6
provides a safe6
basic and advanced5
normal normal 22px27px5
agility nose work5
obedience agility nose5
n n nninfosvgtypeshapeviewbox05
advanced obedience agility5
city sd obedience5
list of classes5
n nninfosvgtypeshapeviewbox0 05
classes including basic5
work and rally5
obedience classes etc5
sd obedience classes5
solid rgba0 04
0 0fontnormal normal4
inotpro-gallery-lovedcomp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
acomp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
info-element-descriptioncomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
rgba54 149 1514
normal normal 16px14em4
nninfosvgtypeshapeviewbox0 0 2004
0 0 04
gallery-slideshow-info info-element-title--itemfontslideshow normal4
info-element-titlecomp-k6tlvb7d pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
000000backgroundrgba0 0 04
antonsans-serif--itemfontcolorslideshow 000000colorrgb0 04
normal 22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-k6tlvb7d4
gallery-slideshow-info gallery-item-descriptioncomp-k6tlvb7d pro-galleryinline-styles4
6px 0px rgba000064
255 255 importantcomp-k6tlvb7d4
255 importantcomp-k6tlvb7d pro-galleryinline-styles4
100px 6px 0px4
1background-colorrgba255 255 2554
info-element-title--itemfontslideshow normal normal4
gallery-slideshow-info gallery-item-titlecomp-k6tlvb7d pro-galleryinline-styles4
0 importantcomp-k6tlvb7d pro-galleryinline-styles4
info-element-descriptioncomp-k6tlvb7d pro-galleryinline-styles gallery-item-container4
border-width1px background-colorrgba255 2554
255 255 1border-stylesolidborder-colorrgba2214
255 1border-stylesolidborder-colorrgba221 1634
163 30 14
1border-stylesolidborder-colorrgba221 163 304
gallery-item-wrapper gallery-slideshow-info svg4
info-element-titlecomp-k6tlvb7d pro-galleryinline-styles gallery-item-container4
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-k6tlvb7d pro-galleryinline-styles4
0 0 importantcomp-k6tlvb7d4
gallery-item-wrapper gallery-item-hover svg4
classes etc typemetapropsnamedescriptioncontentlooking3
up your payment3
your payment method3
temperature controlled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour3
controlled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fully3
typemetapropsnamedescriptioncontentlooking for professional3
13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fully matted3
gallery-item-hoverbefore--itemopacity 000000backgroundrgba0 03
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
border-stylesolidborder-colorrgba249 249 2493
149 151 13
background-colorrgba54 149 1513
255 1 style-khwbxd24navcontainer3
255 255 13
249 1background-colorrgba255 2553
249 249 1background-colorrgba2553
border-width2px border-stylesolidborder-colorrgba249 2493
fill fff stroke3
transitioncolor 04s ease3
05s ease 0s3
-webkit-tap-highlight-colorrgba0 0 03
0 06 03
positionfixed importantleftauto importantz-index503
normal 16px14em spinnakersans-serif3
normal normal 18px14em3
ease 0s style-khwbxd24repeaterbuttondata-stateover3
fff stroke fff3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
255comp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
buttoncomp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
0comp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
0 0comp-k6tlvb7d pro-fullscreen-wrapper3
comp-k6tlvb7d pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
spinnakersans-seriftext-decoration comp-k6tlvb7d pro-fullscreen-wrapper3
255 255comp-k6tlvb7d pro-fullscreen-wrapper3
stroke fff stroke-width3
normal normal 40px50px3
ffffffcolorrgb255 255 255comp-k6tlvb7d3
spinnakersans-serif--itemdescriptionfontcolorslideshow 000000colorrgb0 03
15px14em spinnakersans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
normal 15px14em spinnakersans-serif--itemdescriptionfontcolorslideshow3
000000colorrgba0 0 03
fff stroke-width 03
dog to learnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec2-1245-4be7-9b70-e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aee-ea94-4bd9-a243-522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aee-ea94-4bd9-a243-522f68ad2b28idx2ingroupidx1dtoida2169aee-ea94-4bd9-a243-522f68ad2b28width4272height2848itemida2169aee-ea94-4bd9-a243-522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentryway3
normal normal104
pro-galleryinline-styles gallery-item-container61
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator61
0 054
n n35
margin-left calc10031
calc100 980px31
980px 0531
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
255 25527
normal 14px14em26
buttoncomp-k6tlvb7d pro-galleryinline-styles24
dog training23
importantcomp-k6tlvb7d pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
tails dog16
happy tails16
background-colorrgba255 25515
rapid city15
gallery-item-titlecomp-k6tlvb7d pro-galleryinline-styles14
gallery-item-descriptioncomp-k6tlvb7d pro-galleryinline-styles14
custom-button-wrapper buttoncomp-k6tlvb7d14
comp-k6tlvb7d pro-galleryinline-styles13
importantfontnormal normal13
ease 0s13
training area12
fully matted12
font normal11
rgba0 011
0 0611
139 13910
info-element-custom-button-wrapper buttoncomp-k6tlvb7d10
000000colorrgb0 010
04s ease10
0 importantfontnormal9
normal 15px18px9
your dog9
fontnormal normal9
149 1518
14px14em spinnakersans-serif8
info-element-descriptioncomp-k6tlvb7d pro-galleryinline-styles8
info-element-titlecomp-k6tlvb7d pro-galleryinline-styles8
training center8
14px14em spinnakersans-seriftext-decoration8
139 18
area look7
0 2007
black hills7
normal 15px14em7
hills area7
great list7
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-k6tlvb7d7
center rapid7
specialty dog7
ffffffcolorrgb255 2557
look no7
no further7
further happy7
city has7
margin0line-heightnormalletter-spacingnormal txtnew7
professional specialty7
spinnakersans-serif color4f4f4f7
gallery-item-container gallery-slideshow-info6
safe place6
1border-stylesolidborder-colorrgba139 1396
06 importantcomp-k6tlvb7d6
gallery-item-container gallery-item-left-info6
gallery-item-container gallery-item-bottom-info6
gallery-item-container gallery-item-right-info6
normal 25px14em6
255 1border-stylesolidborder-colorrgba1396
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
our facebook6
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-k6tlvb7d6
area provides6
gallery-item-container gallery-item-top-info6
matted floor6
handicap accessible6
5000 sq6
sq ft6
floor handicap6
city sd6
ft facility6
temperature controlled6
border-width0 background-colorrgba2556
60x50 training6
0fontnormal normal6
matted training6
area fully6
nninfosvgtypeshapeviewbox0 05
normal 22px27px5
including basic5
1 style-khwbxd24navcontainer5
sd obedience5
obedience classes5
n nninfosvgtypeshapeviewbox05
advanced obedience5
agility nose5
255 255comp-k6tlvb7d5
obedience agility5
classes etc5
nose work5
classes including5
spinnakersans-serifcolorrgb0 04
solid rgba04
inotpro-gallery-lovedcomp-k6tlvb7d pro-fullscreen-wrapper4
normal 16px14em4
30 14
163 304
1border-stylesolidborder-colorrgba221 1634
acomp-k6tlvb7d pro-fullscreen-wrapper4
255 1border-stylesolidborder-colorrgba2214
border-width1px background-colorrgba2554
204 2044
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-k6tlvb7d4
0 importantcomp-k6tlvb7d4
0 0fontnormal4
txtnew ul4
rgba54 1494
0px rgba000064
6px 0px4
gallery-slideshow-info svg4
100px 6px4
gallery-item-hover svg4
inotpro-gallery-lovednotinfo-element-lovedcomp-k6tlvb7d pro-galleryinline-styles4
gallery-item-hoverdefaultforce-hoverbeforecomp-k6tlvb7d pro-galleryinline-styles4
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-k6tlvb7d pro-galleryinline-styles4
gallery-slideshow-info gallery-item-titlecomp-k6tlvb7d4
1background-colorrgba255 2554
000000backgroundrgba0 04
color ffffff4
gallery-slideshow-info info-element-title--itemfontslideshow4
background-color ffffff4
gallery-item-wrapper gallery-itemgallery-item-video4
255 importantcomp-k6tlvb7d4
gallery-slideshow-info gallery-item-descriptioncomp-k6tlvb7d4
antonsans-serif--itemfontcolorslideshow 000000colorrgb04
info-element-title--itemfontslideshow normal4
13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour fully3
payment method3
your payment3
up your3
etc typemetapropsnamedescriptioncontentlooking3
normal 18px14em3
controlled 13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour3
normal 40px50px3
antonsans-serif color0000003
style-khwbxd24navcontainerarrow style-khwbxd24navcontainersvgcontainer3
stroke fff3
fff stroke3
fill fff3
-webkit-tap-highlight-colorrgba0 03
svg positionabsolutetop0right0bottom0left0width100height100marginauto3
svg overflowvisible3
0s style-khwbxd24repeaterbuttondata-stateover3
selectdata-previewerror style-khwbxd24navcontainerarrow3
151 13
stroke-width 03
background-colorrgba54 1493
255 13
249 1background-colorrgba2553
249 2493
border-stylesolidborder-colorrgba249 2493
border-width2px border-stylesolidborder-colorrgba2493
transitioncolor 04s3
05s ease3
fff stroke-width3
ol ul3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
255comp-k6tlvb7d pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
buttoncomp-k6tlvb7d pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
0comp-k6tlvb7d pro-fullscreen-wrapper3
0 0comp-k6tlvb7d3
comp-k6tlvb7d pro-fullscreen-wrapper3
spinnakersans-seriftext-decoration comp-k6tlvb7d3
16px14em spinnakersans-serif3
ultxtnew ol3
gallery-item-hoverbefore--itemopacity 000000backgroundrgba03
positionfixed importantleftauto3
importantleftauto importantz-index503
79 793
06 03
spinnakersans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
15px14em spinnakersans-serif--itemdescriptionfontcolorslideshow3
000000colorrgba0 03
learnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec2-1245-4be7-9b70-e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aee-ea94-4bd9-a243-522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aee-ea94-4bd9-a243-522f68ad2b28idx2ingroupidx1dtoida2169aee-ea94-4bd9-a243-522f68ad2b28width4272height2848itemida2169aee-ea94-4bd9-a243-522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentryway welcome3
normal176
pro-galleryinline-styles135
0132
164
gallery-item-containerpro-gallery-mobile-indicator61
gallery-item-container61
gallery-item-wrapper58
training45
n43
dog38
color37
background-color37
your33
gallery-slideshow-info32
pro-fullscreen-wrapper32
980px31
0531
calc10031
margin-left31
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
227
buttoncomp-k6tlvb7d27
14px14em26
happy25
importantcomp-k6tlvb7d22
320
area19
comp-k6tlvb7d18
txtnew18
tails17
spinnakersans-serif16
positionabsolutetop0right0bottom0left016
classes16
rapid15
background-colorrgba25515
city15
svg15
you15
custom-button-wrapper14
gallery-item-titlecomp-k6tlvb7d14
gallery-item-descriptioncomp-k6tlvb7d14
info-element-custom-button-wrapper14
importantfontnormal13
0s13
ease13
style-khwbxd24navcontainer13
gallery-item-bottom-info12
color4f4f4f12
fully12
matted12
gallery-item-top-info12
0612
gallery-item-left-info12
gallery-item-right-info12
our12
font11
rgba011
has11
obedience11
style-khwbxd24navcontainerarrow11
solid10
great10
04s10
000000colorrgb010
we10
ul10
fontnormal9
spinnakersans-seriftext-decoration9
15px18px9
style-kge0xen0input9
look8
style-khwbxd24repeaterbuttonwrapper8
48
important8
58
68
ffffff8
0px8
center8
info-element-titlecomp-k6tlvb7d8
info-element-descriptioncomp-k6tlvb7d8
color0000008
professional7
15px14em7
77
specialty7
list7
further7
ffffffcolorrgb2557
hills7
avenir-lt-w0135-light1475496sans-seriftext-decoration7
facility7
no7
black7
var7
1px7
border-width07
margin0line-heightnormalletter-spacingnormal7
ol7
style-khwbxd24navcontainerarrowstyle-khwbxd24navcontainerleft-direction6
us6
facebook6
class6
basic6
sd6
86
my6
fff6
96
style-kge0xenttextarea6
avenir-lt-w0185-heavy1475544sans-seriftext-decoration6
0fontnormal6
1border-stylesolidborder-colorrgba1396
border-radius06
25px14em6
agility6
sq6
style-khwbxd24navcontainerarrowstyle-khwbxd24navcontainerright-direction6
temperature6
handicap6
style-khwbxd24repeaterbuttondata-stateover6
floor6
if6
60x506
style-khwbxd24navcontainerarrowstyle-khwbxd24navcontainercenter-direction6
controlled6
provides6
106
ft6
safe6
place6
welcome6
accessible6
up5
22px27px5
divpro-gallery-parent-container5
ultxtnew5
payment5
255comp-k6tlvb7d5
etc5
style-khwbxd24repeaterbuttonborderwrapper5
nninfosvgtypeshapeviewbox05
rally5
work5
nose5
advanced5
including5
114
store4
inotpro-gallery-lovednotinfo-element-lovedcomp-k6tlvb7d4
info-element-title--itemfontslideshow4
antonsans-serif--itemfontcolorslideshow4
0000004
16px14em4
gallery-item-text4
124
000000backgroundrgba04
gallery-item-hoverdefaultforce-hoverbeforecomp-k6tlvb7d4
gallery-item-hoverdefaultnothide-hoverbeforebackground0000004
b0b0b04
rgba544
gallery-itemgallery-item-video4
134
acomp-k6tlvb7d4
inotpro-gallery-lovedcomp-k6tlvb7d4
spinnakersans-serifcolorrgb04
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-k6tlvb7d4
100px4
rgba000064
style-kge0xeo7link4
style-kge0xeo7label4
click4
144
1background-colorrgba2554
154
1border-stylesolidborder-colorrgba2214
lb1itemscontainer4
border-width1px4
style-khwbxd24repeaterbuttonlabel4
border-width2px4
style-kge0xeo7labelwrapper4
box-shadownone4
6px4
18px14em3
border-stylesolidborder-colorrgba2493
vector-effectnon-scaling-stroke3
antonsans-serif3
background-colorrgba543
typemetapropsnamedescriptioncontentlooking3
can3
transitioncolor3
22px14em3
border-radius80px3
style-khwbxd24repeaterbuttondata-statedrop3
new3
visitors3
13linktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename3cfb9b12-2c01-4583-8d5b-385ab98e630fjpename54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegmediaurl54af57bee1e8017e9b41c785c07a2a8e9357eemv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left0width1920height880offsettop0left0right1920bottom880groupoffsettop0left0right19199999999999998bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left0right1920bottom880visibletruerenderedtruerequiredtrueidg1a342868e-56ca-4081-b70a-8dc828983186idx1stripidx1instripidx2islastgroupfalseitemsida342868e-56ca-4081-b70a-8dc828983186idx1ingroupidx1dtoida342868e-56ca-4081-b70a-8dc828983186width4272height2848itemida342868e-56ca-4081-b70a-8dc828983186issecurefalseorderindex1563814684155375metadatatitleour3
object3
online3
selectdata-previewhover3
method3
selectfocus3
art3
get3
style-khwbxd24navcontainersvgcontainer3
selectdata-previewfocus3
selectdata-errortrue3
selectdata-previewerror3
style-khwbxd24navcontainerright-direction3
style-khwbxd24navcontainercenter-direction3
style-khwbxd24navcontainerleft-direction3
true3
style-khwbxd24repeaterbuttondata-stateselected3
want3
terry3
positive3
40px50px3
taken3
able3
content3
gallery-item-hoverbefore--itemopacity3
strc1data-responsive3
text-alignleft3
text-aligncenter3
very3
good3
05s3
000000colorrgba03
selecthover3
oldirrtl3
spinnakersans-serif--itemdescriptionfontcolorslideshow3
-webkit-tap-highlight-colorrgba03
positionabsolutetop0right0bottom0left0width100height100marginauto3
strc1inlinecontent3
stroke-width3
more3
fullscreen-mobile-bar3
positionfixed3
importantleftauto3
overflowvisible3
importantz-index503
topautobottom03
contact3
fullscreen-social3
fullscreen-nav3
stroke3
fullscreen-side-bar-social3
0comp-k6tlvb7d3
style-kg8jh7orbg3
have3
dogs3
fill3
left10pxright10px3
style-khwbx5gkbg3
learnlinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2848width4272filename0ed45ec2-1245-4be7-9b70-e25bafa3428ajpename54af57524b9f16bc1a4a82917d131c47e90724mv2jpegmediaurl54af57524b9f16bc1a4a82917d131c47e90724mv2jpegdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautoroundedstylewidth1920cubedwidth1920height880cubedheight880top0bottomautoleft0rightautowidth1920maxwidth4272outerwidth1920infowidth0margins0ratio15cropratio21818181818181817iscroppedtruecroptypefillheight880maxheight2848outerheight880infoheight0grouptop0left1920width1920height880offsettop0left1920right3840bottom880groupoffsettop0left1920right3840bottom880orientationlandscapeisportraitfalseislandscapetruevisibilitytype1width1920height880infoheight0infowidth0ratio21818181818181817top0left1920right3840bottom880visibletruerenderedtruerequiredtrueidg2a2169aee-ea94-4bd9-a243-522f68ad2b28idx2stripidx1instripidx3islastgrouptrueitemsida2169aee-ea94-4bd9-a243-522f68ad2b28idx2ingroupidx1dtoida2169aee-ea94-4bd9-a243-522f68ad2b28width4272height2848itemida2169aee-ea94-4bd9-a243-522f68ad2b28issecurefalseorderindex15638146841557498metadatatitleentryway3

Who hosts Happytailsdogtraining.biz?

Happytailsdogtraining.biz Hosting Provider Information

Hosted IP Address:185.230.63.171
Hosted Hostname:185.230.63.171
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United StatesUS
Location Latitude:39.018
Location Longitude:-77.539
Webserver Software:Pepyaka/1.19.0

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%

HTTP Header Analysis for Happytailsdogtraining.biz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 15 Apr 2021 20:52:59 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1618519978.920475073383120762
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVh6aqXNQlfs1DVxLIoL9NTV,qquldgcFrj2n046g4RNSVOgjK1IbQcmp 2yVeKIZh3A=,2d58ifebGbosy5xc FRalktUUynoFPKweczj6M34cyorEXQY60Hqyb262zFN 7E8GgqFbFMYwiXnFojPwdof6AHwarp/yDvfNccUdnfllgg=,2UNV7KOq4oGjA5 PKsX47HMD3XjoxaKbTYcffYmebS0=,IaDuTAMGGvhXtruM6nHg6syOePmpEUnbaEHZVo6vH qTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,jmlhAcZUgDXxQVz2aYgmJKZLCJ4aPxHkDaIE66MQOfM4NDSe ETgRnbWoBvyJ/FpSYblWJ1 I4NCiXX q5JMPA==,IaDuTAMGGvhXtruM6nHg6syOePmpEUnbaEHZVo6vH qTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LoUK8/saGAmOxZWtpubo2rV6V640/TFv9nWANtlB5ochfSNyLrF1JYWTzZLeAZtIhQRYCpOunVQsePLH9r9DNA==,l7Ey5khejq81S7sxGe5Nk4FTWojmOs6AFVaAYgnlafyTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LXlT8qjS5x6WBejJA3 gBSaJOHYTaX3K4D31tPV1N3BNG KuK VIZfbNzHJu0vJu,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHFMXkDojIJAjv1DgXWy8qlZPTDcmuhtrByxcrtes L9x1Ukz4HcqTumJNalmHEun7s=,LXlT8qjS5x6WBejJA3 gBSaJOHYTaX3K4D31tPV1N3BNG KuK VIZfbNzHJu0vJu,l7Ey5khejq81S7sxGe5Nk32QNI1ap7QhtQmchK3EqXlXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,CU5GbgCT5nWPaA3tUS4mLDJ57HN4rKLyBiFEW4Gh4LiddurH4oxnHz43aUHSofKAzUBQ5k1progPSSEFzlfR7ViB5QmpRe2J37zq9nDD6cs=
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Happytailsdogtraining.biz Domain Nameserver Information

HostIP AddressCountry
ns9.wixdns.net 216.239.34.101
ns8.wixdns.net 216.239.32.101


Need to find out who hosts Happytailsdogtraining.biz?


Domain Registration (WhoIs) information for Happytailsdogtraining.biz

 Domain Name: happytailsdogtraining.biz
Registry Domain ID: D22927042-BIZ
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2020-01-03T17:38:55Z
Creation Date: 2008-01-29T17:27:13Z
Registry Expiry Date: 2022-01-28T23:59:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Terry Besler
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: South Dakota
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns9.wixdns.net
Name Server: ns8.wixdns.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-11-02T20:30:46Z

Websites with Similar Names

Happy--hacker.com
happy--hacker.com is coming soon
Happy--home.com
Home - Happy Home Maison Bois
Happy-012.com
happy-012.com - happy-012 Resources and Information.
Happy-1news.com
happy-1news.com
Happy-2-cook.com
Happy Cooking – Pour ceux qui aiment manger sans passer leur vie en cuisine
Happy-2.com
HugeDomains.com
Happy-2020.site
Домен не прилинкован ни к одной из директорий на сервере!

Recently Updated Websites

Aoavip1016.app (2 seconds ago.)Showthefash.com (3 seconds ago.)Bimbesbox.com (4 seconds ago.)Carryhandgun.com (4 seconds ago.)Camachofamily.us (5 seconds ago.)Switchthinkingway.com (6 seconds ago.)Nord-confluence.com (6 seconds ago.)5127727.com (6 seconds ago.)Cherrybiotech.com (6 seconds ago.)Narayanlawfirm.com (7 seconds ago.)Factory-dorsten.de (8 seconds ago.)Hf74.club (8 seconds ago.)Barbecueblackbelt.com (9 seconds ago.)Sharonpira.com (10 seconds ago.)Europeanmassclaim.com (10 seconds ago.)Legalopinion.guru (10 seconds ago.)Cecilehotel.com (11 seconds ago.)Freepile.org (11 seconds ago.)Thehomesteadexperiment.com (11 seconds ago.)Woundeaze.info (12 seconds ago.)Router24.net (13 seconds ago.)Wpthemeplugin.xyz (13 seconds ago.)Chuaduongha.com (14 seconds ago.)Riicco.com (14 seconds ago.)2mworld.com (14 seconds ago.)Guiacomercialdecordoba.com (15 seconds ago.)Neptunediving-ski.com (15 seconds ago.)Henrylang.net (16 seconds ago.)Flightserver.net (16 seconds ago.)Cynthiamcintoshcoach.com (17 seconds ago.)

Recently Searched Keywords

canna australia (2 seconds ago.)calya (7 seconds ago.)��Ұ쭳�9���� (7 seconds ago.)auto racing (9 seconds ago.)ионизатор-озонатор воздуха автомобильный (11 seconds ago.)des maladies (13 seconds ago.)موعد مباراة مان سيتي ضد بيرنلي manchester city vs. burnley اليوم الأربعاء 30 (18 seconds ago.)18:00 kupol rodniki - bk burevestnik jaroslav maçı canlı izle 24 kasım 2020 (20 seconds ago.)rojo lyrics (22 seconds ago.)un lien pour (24 seconds ago.)laissez des (25 seconds ago.)mothersontaboo (28 seconds ago.)fried labneh (29 seconds ago.)3 metra над небом 2 (32 seconds ago.)do sexual health (34 seconds ago.)sprintzeal (35 seconds ago.)gestión ambiental (35 seconds ago.)xbet reviews (38 seconds ago.)0 204f74 (38 seconds ago.)whatsapp 05321651531 (39 seconds ago.)pinterest flipboard rss (42 seconds ago.)女士包包 英文 (43 seconds ago.)black stretchable (44 seconds ago.)practo (51 seconds ago.)thaiesaanfood (54 seconds ago.)刀劍神域系列 (58 seconds ago.)increase restaurant sales (59 seconds ago.)more order (1 minute 2 seconds ago.)chế độ ăn uống như thế nào là hợp lý với các bệnh nhân bị trào ngược dạ dày (1 minute 5 seconds ago.)vipin sharma ias (1 minute 5 seconds ago.)