Hasselblad.se  |  Hasselblad
Low trust score  | 



Hasselblad.se Website Information

Website Ranks & Scores for Hasselblad.se

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:160,521
Majestic Rank Majestic Rank:383,505
Domain Authority Domain Authority:54%
DMOZ DMOZ Listing:No

Domain Information for Hasselblad.se

Domain Registrar: NIC-SE
Registration Date:1993-08-25  2 decades 5 years 9 months ago
Expiration Date:2015-12-31  3 years 5 months 1 week ago

Whois information for hasselblad.se

Full Whois Lookup for Hasselblad.se Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Hasselblad.se. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: hasselblad.se
holder: karvic7656-00001
admin-c: eds0903-00002
tech-c: eds0903-00002
billing-c: eds0903-00001
created: 1993-08-25
modified: 2016-11-04
expires: 2017-12-31
transferred: 2013-03-19
nserver: ns4.eurodns.com
nserver: ns3.eurodns.com
nserver: ns2.eurodns.com
nserver: ns1.eurodns.com
dnssec: unsigned delegation
status: ok
registrar: EuroDNS S.A

Who hosts Hasselblad.se?

Hasselblad.se is hosted by Datacenter Luxembourg S.A. in Luxembourg.
Hasselblad.se has an IP Address of 80.92.65.144 and a hostname of tatooine-2.eurodns.com and runs nginx/1.4.6 (Ubuntu) web server.



Hasselblad.se Web Server Information

Hosted IP Address:80.92.65.144
Hosted Hostname:tatooine-2.eurodns.com
Service Provider:Datacenter Luxembourg S.A.
Hosted Country:LuxembourgLU
Location Latitude:49.75
Location Longitude:6.1667
Webserver Software:nginx/1.4.6 (Ubuntu)

HTTP Header Analysis for Hasselblad.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Date: Wed, 03 Jun 2015 10:34:17 GMT
Server: nginx/1.4.6 (Ubuntu)
X-Powered-By: PHP/5.5.9-1ubuntu4.7
Content-Length: 7406
Connection: keep-alive


Need to find out who hosts Hasselblad.se?

Hasselblad.se Free SEO Report

Website Inpage Analysis for Hasselblad.se

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hasselblad.se

croatiasystemchoose countryx1dusyou haveyouhasselbladoncesubmitsubmit yournotallgalleryonce youprogramx systementriesone imagesystem accessoriesvote0exposuremastersimagingh systemchooseonce you haveclickcameraaccessoriesyourmustyour entriesregisterscannerislandpleasesaintcontactmoreourimagespressrepublicdownloadshsoftwareautocountrymanstarshaveonefirmwareunitedimagexcategoryvarislandsinspirecamerasnewserviceguineah6d100cequipment

Longtail Keyword Density for Hasselblad.se

KeywordsOccurences
once you have3
you have8
choose country4
once you3
your entries3
one image3
h system3
submit your3
x system3
system accessories3
hasselblad18
you15
islands14
your12
have11
system10
masters8
image8
choose6
vote6
please6
new6
our6
cameras5
submit5
images5
once5
stars5
republic4
country4
united4
accessories4
exposure4
04
not4
entries4
one4
click4
camera4
register4
software4
gallery4
var3
auto3
h6d-100c3
firmware3
program3
all3
downloads3
category3
more3
x1d3
must3
h3
saint3
press3
contact3
us3
imaging3
man3
inspire3
scanner3
guinea3
x3
croatia3
island3
equipment3
service3

What are the nameservers for hasselblad.se?

Hasselblad.se Domain Nameserver Information

HostIP AddressCountry
ns4.eurodns.com 204.74.111.130United States United States
ns3.eurodns.com 204.74.67.130United States United States
ns2.eurodns.com 204.74.110.130United States United States
ns1.eurodns.com 204.74.66.130United States United States

Hasselblad.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hasselblad.se is a scam?