HASTAC: Changing the Way We Teach and Learn

Safety: Low trust score
Year Founded: 2003
Global Traffic Rank: 94,735
Estimated Worth: $154,800

HASTAC is an alliance of more than 14,000 humanists, artists, social scientists, scientists and technologists working together to transform the future of learning.



Domain summary

Last updated
2020-11-04
Domain label
hastac
Domain extension
org
Domain registered:
2003-02-07
Domain updated:
2020-11-04
Global Traffic Rank
94,735
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$154,800
Estimated daily income
$215
Estimated monthly income
$6,540

Rank summary

How is hastac.org ranked relative to other sites:

Percentage of visits to hastac.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hastac.org registered?
A: Hastac.org was registered 18 years, 2 months, 1 week, 3 days, 14 hours, 2 minutes, 54 seconds ago on Friday, February 7, 2003.
Q: When was the WHOIS for Hastac.org last updated?
A: The WHOIS entry was last updated 5 months, 1 week, 6 days, 14 hours, 2 minutes, 54 seconds ago on Wednesday, November 4, 2020.
Q: What are Hastac.org's nameservers?
A: DNS for Hastac.org is provided by the following nameservers:
  • ns1.dreamhost.com
  • ns2.dreamhost.com
  • ns3.dreamhost.com
Q: Who is the registrar for the Hastac.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Hastac.org?
A: Hastac.org ranks 94,735 globally on Alexa. Hastac.org has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Hastac.org each day?
A: Hastac.org receives approximately 17,898 visitors and 107,388 page impressions per day.
Q: What IP address does Hastac.org resolve to?
A: Hastac.org resolves to the IPv4 address 23.185.0.2.
Q: In what country are Hastac.org servers located in?
A: Hastac.org has servers located in the United States.
Q: What webserver software does Hastac.org use?
A: Hastac.org is powered by Nginx webserver.
Q: Who hosts Hastac.org?
A: Hastac.org is hosted by OJSC Vimpelcom in United States.
Q: How much is Hastac.org worth?
A: Hastac.org has an estimated worth of $154,800. An average daily income of approximately $215, which is roughly $6,540 per month.

Hastac.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hastac.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Hastac.org

H1 Headings

0 :

H2 Headings

27 :
  1. Search form
  2. Trending Posts
  3. A walk through the history of Aclimação
  4. The History of West New York, New Jersey
  5. Vlogs, GIFs, Twine, and Macros: Multimodal Writing
  6. I'm Ready with Jazz Hands!
  7. Hacking the History of Hackensack
  8. Elder Care Pods
  9. Walking through Virginia’s Revolutionary History
  10. An Activity to Put a Stop to "Students Don't Read My Comments on their Papers"
  11. HASTAC Picks
  12. Collaborative Close Reading Online
  13. An Activity to Put a Stop to "Students Don't Read My Comments on their Papers"
  14. Putting the Humanities PhD to Work: A conversation with Katina Rogers
  15. The time to reinvest in higher education is now
  16. Collaborative Book Discussion of Franchise by Marcia Chatelain
  17. Recent Posts
  18. So How Are You Planning to Start Your Class Tomorrow?
  19. Ukrainian Rocket Mogul Bridges the Gap in Technology
  20. Assistant Director, Wurtele Center for Leadership, Smith College
  21. Pandemic Pedagogy Reflection 1
  22. The Imagination Desk Podcast
  23. New book offers vital toolbox in visual research methods for LIS
  24. Getting Started
  25. Our Community In Action
  26. Most Recent Comments
  27. Most Active Discussions

H3 Headings

20 :
  1. Blog Post
  2. Blog Post
  3. Blog Post
  4. Blog Post
  5. Blog Post
  6. Blog Post
  7. Blog Post
  8. Blog Post
  9. Blog Post / Teaching & Learning Practices
  10. Blog Post / Teaching & Learning Practices
  11. Blog Post / Educational & Cultural Institutions
  12. Collection
  13. Blog Post / Teaching & Learning Practices
  14. Blog Post / Technology, Networks & Sciences
  15. Blog Post / Teaching & Learning Practices
  16. Blog Post / Humanities, Arts & Media
  17. Blog Post / Teaching & Learning Practices
  18. Being thoughtful on "academizing" and accessibility in poetry writing
  19. Alexandria
  20. A walk through the history of Aclimação

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

71 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-1686931-1

Links - Internal

196:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hastac.org

blog post teachingchatelainblog post1scholars havemy comments0share your52020 nothanknewwehumanitiesstopsciencesoctober 1 2020gifsherethank youculturalbeingtheiryork new jerseycareseptemberallyourcomments 5comments on theirnew jerseyview all4leadershipdrseptember 16mostmacroshistorylearningpost teaching learningreadpostrogersblogdecraenegilfordteaching learningno comments 5throughclassbooksharescholarskatinamechelleactivityviewcultural institutionsactivity to putdigitalyork newputcommunitywalk throughknowoctoberrecentwest new2020 no commentsteachingmacros multimodalwesttwinejerseyinstitutionsgifs twinenew yorkpostshastacampoctober 1west new yorkpost teachingwritingworththrough the historyteaching learning practiceshastac scholarsreadycommentsjoinlearning practices2hastac scholars haveshare your thoughtsartsthoughts3discussioncollaborativeusnoread my commentsyouread mycontentwalkourno commentsexploremynetworksopenmultimodalvaryorkkatina rogersput a stoppractices1 2020technologynowyour thoughtsmechelle decraenegilfordcenterhavecollegenew york new

Longtail Keyword Density for Hastac.org

KeywordsOccurences
2020 no comments8
october 1 20206
blog post teaching5
post teaching learning5
teaching learning practices5
hastac scholars have4
share your thoughts4
through the history3
west new york3
new york new3
york new jersey3
no comments 53
activity to put3
put a stop3
read my comments3
comments on their3
no comments16
blog post16
2020 no8
learning practices7
teaching learning6
hastac scholars6
view all6
october 16
1 20206
post teaching5
katina rogers4
new jersey4
share your4
your thoughts4
mechelle decraene-gilford4
scholars have4
september 163
my comments3
gifs twine3
read my3
comments 53
macros multimodal3
york new3
new york3
west new3
walk through3
cultural institutions3
thank you3
comments24
post19
018
hastac16
blog16
no16
history11
october11
new11
amp10
learning9
you9
all9
18
scholars8
teaching8
my7
september7
practices7
college6
through6
your6
walk6
our6
view6
digital6
have6
technology6
read5
book5
humanities5
share5
leadership5
rogers5
mechelle5
jersey4
katina4
ready4
decraene-gilford4
24
cultural4
most4
worth4
we4
thoughts4
33
put3
stop3
being3
thank3
their3
center3
dr3
43
content3
recent3
collaborative3
chatelain3
discussion3
activity3
join3
now3
posts3
explore3
arts3
networks3
open3
sciences3
here3
community3
institutions3
writing3
class3
care3
us3
know3
west3
york3
gifs3
twine3
macros3
multimodal3
53
var3

Who hosts Hastac.org?

Hastac.org Hosting Provider Information

Hosted IP Address:23.185.0.2
Hosted Hostname:23.185.0.2
Service Provider:OJSC Vimpelcom
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "OJSC Vimpelcom" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
OJSC Vimpelcom
0.0266%

HTTP Header Analysis for Hastac.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 26981
Cache-Control: public, max-age=900
Content-Encoding: gzip
Content-Language: en
Content-Type: text/html; charset=utf-8
Etag: W/"1604462017-0"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Wed, 04 Nov 2020 03:53:37 GMT
Link:; rel="image_src",; rel="canonical",; rel="shortlink"
Server: nginx
X-Drupal-Cache: HIT
X-Frame-Options: SAMEORIGIN
X-Generator: Drupal 7 (https://www.drupal.org)
X-Pantheon-Styx-Hostname: styx-fe2-b-9879df98d-gtkqw
X-Styx-Req-Id: 6c993c5f-1e53-11eb-99ea-aebc0bd61b9f
X-Ua-Compatible: IE=edge,chrome=1
Date: Wed, 04 Nov 2020 04:24:01 GMT
X-Served-By: cache-mdw17367-MDW, cache-lon4249-LON
X-Cache: HIT, HIT
X-Cache-Hits: 1, 1
X-Timer: S1604463842.536093,VS0,VE1
Vary: Accept-Encoding, Cookie, Cookie, Cookie
Age: 920
Accept-Ranges: bytes
Via: 1.1 varnish, 1.1 varnish

Hastac.org Domain Nameserver Information

HostIP AddressCountry
ns1.dreamhost.com 162.159.26.14
ns2.dreamhost.com 162.159.26.81
ns3.dreamhost.com 162.159.27.84


Need to find out who hosts Hastac.org?


Domain Registration (WhoIs) information for Hastac.org

 Domain Name: HASTAC.ORG
Registry Domain ID: D98309836-LROR
Registrar WHOIS Server: whois.dreamhost.com
Registrar URL: http://www.dreamhost.com/
Updated Date: 2020-07-02T14:11:21Z
Creation Date: 2003-07-02T19:02:37Z
Registry Expiry Date: 2021-07-02T19:02:37Z
Registrar Registration Expiration Date:
Registrar: New Dream Network, LLC dba DreamHost Web Hosting
Registrar IANA ID: 431
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +213.2719359
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Proxy Protection LLC
Registrant State/Province: CA
Registrant Country: US
Name Server: NS1.DREAMHOST.COM
Name Server: NS2.DREAMHOST.COM
Name Server: NS3.DREAMHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-06T23:31:48Z

Websites with Similar Names

Hasta-bakici.com
Hasta Bakıcı, Hasta Bakıcısı | Yatılı Hasta Bakıcı | Gündüzlü Hasta Bakıcı | Yatalak Hasta Bakıcı
Hasta-gmbh.com
Hier entsteht eine neue Homepage
Hasta-la-ultra.de
Startseite - Hasta-La-Ultra
Hasta-luego.com
PLUVINEL /// The PLUVINEL COMPANY est spécialisé dans le divertissement

Recently Updated Websites

Miamiopenuniversity.us (1 second ago.)Bentonvilleprc.org (1 second ago.)Gergoenagy.com (2 seconds ago.)Almahad.in (2 seconds ago.)Solutionscarbon.com (2 seconds ago.)Politpskov.com (3 seconds ago.)Jjfkmedia.live (3 seconds ago.)Zedem.net (3 seconds ago.)Angelxantana.shop (3 seconds ago.)Ivotedbymail.today (3 seconds ago.)Goscout.biz (3 seconds ago.)Razaosaka.best (4 seconds ago.)Makroplace.com (4 seconds ago.)Atacadozapata.com.br (4 seconds ago.)Promachatpackexpo.com (4 seconds ago.)Naturamedicin.com (4 seconds ago.)Heronettes.org (4 seconds ago.)Domain.be (4 seconds ago.)Cacaoby.com (5 seconds ago.)Unitedinvestor.com (5 seconds ago.)Spreadit.co.kr (5 seconds ago.)Krufarhiv.com (5 seconds ago.)Sailmotorsports.com (5 seconds ago.)Greenlidenvirosciences.com (5 seconds ago.)Utexas.org (5 seconds ago.)Nanobiodx.com (6 seconds ago.)Kij786g5.com (6 seconds ago.)Mountainstatesguideservice.com (6 seconds ago.)Totalgolfcharlotte.com (6 seconds ago.)Sagitha.com (6 seconds ago.)

Recently Searched Keywords

wwapp6.jpg (1 second ago.)z 100 (1 second ago.)athome south africa (3 seconds ago.)athome online services (4 seconds ago.)21 pc (4 seconds ago.)athome near me (5 seconds ago.)athome login (5 seconds ago.)athome india (6 seconds ago.)athome camera pc software (7 seconds ago.)athome camera (7 seconds ago.)zee 3 (8 seconds ago.)athom (8 seconds ago.)mono bp40 range (9 seconds ago.)graw (11 seconds ago.)технический план сооружения (12 seconds ago.)66 66 (13 seconds ago.)aceinfosolutions jobs (17 seconds ago.)vr vr (20 seconds ago.)gstererek (21 seconds ago.)php projects for students free download (22 seconds ago.)pasta maliyetleri (28 seconds ago.)nbspi (29 seconds ago.)rejuvenation (30 seconds ago.)bottoned floral butterfly print ruffles dress (31 seconds ago.)frypan (36 seconds ago.)10  (39 seconds ago.)奉化莼湖工业区独门独户标准厂房占地3.07亩,建筑面积3000平方,证件齐 (40 seconds ago.)rev pro (41 seconds ago.)kegunaan (44 seconds ago.)tuyển nhân viên kinh doanh (45 seconds ago.)