HD SEX Clips - Millions of HD XXX scenes with sweet things for you.

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

We have huge number of hot hd sex clips selected for the unforgettable 4k porn tube. Get real sexual pleasure with the most attractive chicks.



Domain summary

Last updated
2020-12-29
Domain label
hdsex
Domain extension
kim
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Hdsex.kim registered?
A: Hdsex.kim was registered 1 year, 4 weeks, 1 day, 6 hours, 28 minutes, 21 seconds ago on Tuesday, December 29, 2020.
Q: When was the WHOIS for Hdsex.kim last updated?
A: The WHOIS entry was last updated 1 year, 4 weeks, 1 day, 6 hours, 28 minutes, 21 seconds ago on Tuesday, December 29, 2020.
Q: What are Hdsex.kim's nameservers?
A: DNS for Hdsex.kim is provided by the following nameservers:
  • chad.ns.cloudflare.com
  • kim.ns.cloudflare.com
Q: Who is the registrar for the Hdsex.kim domain?
A: The domain has been registered at .
Q: What is the traffic rank for Hdsex.kim?
A: Hdsex.kim has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hdsex.kim each day?
A: Hdsex.kim receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hdsex.kim resolve to?
A: Hdsex.kim resolves to the IPv4 address 172.67.186.120.
Q: In what country are Hdsex.kim servers located in?
A: Hdsex.kim has servers located in the United States.
Q: What webserver software does Hdsex.kim use?
A: Hdsex.kim is powered by CloudFlare webserver.
Q: Who hosts Hdsex.kim?
A: Hdsex.kim is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Hdsex.kim worth?
A: Hdsex.kim has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Hdsex.kim Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hdsex.kim Free SEO Report

Website Inpage Analysis for Hdsex.kim

H1 Headings

1 :
  1. HD Sex Movies

H2 Headings

7 :
  1. Best clips
  2. Recent videos
  3. pornstars A-Z list
  4. Top paysites
  5. Hottest porn searches
  6. Popular categories
  7. Best Sources

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

193 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1415:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hdsex.kim

veronicaass4944xxxcarmenstoneagofree39janemonroesarahannajamesmarieyearsmadisonalexreedlustvalentinaclaudiadillion3727devineadded 2042sandersangela11dannybritney28pornhubcom related categoriesangelinaryderjessiesummerdollagopaigepornmandytylerpornhubcomscott18jonesvan41clunataylorriveraerickenzielucy36rosefoxxxlana23months agofreecorykellyjohnrhodestexas28relatedsamanthamollyaddedclitjessica15clipsmorettichadgreyloveraepornobelleryan481438audreyrose 11jaydenadrianaadded 10 monthstiffanyharperrainadultwyldekarma29carteramber10 months agofreebella24hd sexlee 11nikitajordanalexaadded 2 yearsmia2630natalybabelilycourtneyjasmineouralexisaubreystarremmavideocategories assfoxmichaelsanistonbell16nicolevonzoey935tubemayajadealyssaxrileyevansella32eva5nickholly34leimichelle11 months12mariapornstars10paradeblondejulieblackwhiteninacaseybcreampie25hotsophiabrandiyoungdiamondmarknoir3brookethorne43videosadded 11 monthspornhubcom relatedcategoriesangelpricedanielssunnyheartparkerst11 amber7haleylady2 yearsginajensenleeallmary41733firstrachelwestblueliyousky45months ago6added 11lenagoldvanessa50anyaadded 10violetemilyashleymonthssashakatiesaranikki13fuckdayerinrelated categories assknudejennahclipscom2021oliviachloebase22star19cummings47chase46clit xxxvalentinejulialondonsweet31gamblecoxheatherjayhazesex1greenrelated categorieslynn 16ann40lexiarielgracepaulfoxxpinkcindyadamslanecatavasierra10 monthsttaylor 11maturekendrasummershdvictoriakayhclipscom related categoriesjmorganhclipscom relatedbanksdeeivylynnleigh51

Longtail Keyword Density for Hdsex.kim

KeywordsOccurences
added 10 months97
added 11 months13
pornhubcom related categories11
related categories ass6
10 months agofree4
added 2 years4
hclipscom related categories3
added 1097
10 months97
related categories16
added 1113
11 months13
pornhubcom related11
categories ass6
months agofree5
2 years4
rose 114
added 24
lynn 163
lee 113
clit xxx3
11 amber3
hclipscom related3
hd sex3
months ago3
taylor 113
0200
added114
1111
months110
272
364
459
554
650
740
839
934
1029
1128
1227
1327
xxx24
1423
porn23
1521
1620
categories19
related16
lee16
1716
taylor15
rose15
1815
angel14
1914
2013
sex13
2112
black12
james11
pornhubcom11
2211
2311
mia11
2410
alexis10
alex9
love9
259
269
ass9
279
starr8
288
stone8
nikki8
belle8
298
diamond8
eva8
rae8
monroe8
lynn8
308
samantha7
jessica7
jenna7
317
white7
nicole7
victoria7
holly7
327
chase7
riley7
marie7
tiffany7
videos7
hot7
lily7
vanessa6
336
jones6
fox6
brooke6
alexa6
346
ann6
star6
jay6
foxx6
summers6
valentina6
bella6
lady6
356
ryan6
anna6
amber6
lane5
ashley5
lexi5
banks5
scott5
gold5
365
hd5
sweet5
nina5
jade5
katie5
valentine5
375
lana5
luna5
our5
j5
385
jane5
adams5
pornstars5
395
grey5
years5
agofree5
carmen4
daniels4
carter4
404
zoey4
madison4
evans4
blue4
b4
gina4
brandi4
you4
kay4
jessie4
414
jasmine4
michaels4
all4
green4
john4
emma4
price4
dee4
chloe4
clips4
jensen4
sky4
cindy4
porno4
morgan4
leigh4
audrey4
424
veronica4
cat4
heart4
adriana4
434
nick4
sunny4
t4
britney4
tyler4
thorne4
444
li4
london4
west4
rachel4
mandy4
jayden3
dillion3
cummings3
sasha3
sara3
harper3
sarah3
haley3
heather3
sophia3
reed3
angela3
summer3
cory3
453
violet3
paul3
kendra3
aniston3
sierra3
lucy3
kenzie3
maria3
mark3
mary3
molly3
nataly3
parker3
st3
lena3
von3
lust3
karma3
k3
nikita3
julie3
julia3
jordan3
olivia3
ava3
texas3
grace3
rivera3
noir3
ago3
babe3
x3
ariel3
ivy3
anya3
young3
nude3
bell3
gamble3
michelle3
paradeblonde3
hclipscom3
devine3
angelina3
emily3
kelly3
463
foxxx3
pink3
maya3
moretti3
rain3
alyssa3
473
haze3
483
aubrey3
adult3
paige3
creampie3
mature3
erin3
eric3
ella3
ryder3
clit3
day3
tube3
doll3
van3
video3
sanders3
493
rhodes3
claudia3
503
courtney3
first3
513
chad3
casey3
lei3
fuck3
cox3
c3
wylde3
base3
danny3

Who hosts Hdsex.kim?

Hdsex.kim Hosting Provider Information

Hosted IP Address:172.67.186.120
Hosted Hostname:172.67.186.120
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
T-Mobile USA, Inc.
1.1173%

HTTP Header Analysis for Hdsex.kim

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 29 Dec 2020 03:06:58 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: User-Agent
CF-Cache-Status: DYNAMIC
cf-request-id: 074e0f9edc000007967f26c000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=gIKORyjIKWO6PFMAxIzo7ZG7xIY8QQ4Atjgk+x0BTawOVL2+KZaCKLZijz+Qlvw7l0AllhVi/6+C5PmJwvS+/6L3zniuzpzF0Wn3HYlG"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 60904ede28440796-LHR
Content-Encoding: gzip

Hdsex.kim Domain Nameserver Information

HostIP AddressCountry
chad.ns.cloudflare.com 173.245.59.82
kim.ns.cloudflare.com 173.245.58.126


Need to find out who hosts Hdsex.kim?


Domain Registration (WhoIs) information for Hdsex.kim

 Domain Name: HDSEX.KIM
Registry Domain ID: D503300001183083823-LRMS
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: www.namecheap.com
Updated Date: 2020-04-05T20:38:53Z
Creation Date: 2020-02-05T10:18:31Z
Registry Expiry Date: 2021-02-05T10:18:31Z
Registrar Registration Expiration Date:
Registrar: NameCheap, Inc
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: WhoisGuard, Inc.
Registrant State/Province: Panama
Registrant Country: PA
Name Server: KIM.NS.CLOUDFLARE.COM
Name Server: CHAD.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-12-29T03:05:58Z

Websites with Similar Names

Hdsex-xxx.com
Best Quality Porn Video For You Every Day
Hdsex.kim
HD SEX Clips - Millions of HD XXX scenes with sweet things for you.
Hdsex.org
HD Sex Videos. Free Porn Tube. XXX Fuck Movies. Hot Nude Girls!
Hdsex.red
Скачать порно видео - парнуха на телефон на hdsex.tv
Hdsex.team
hdsex.team - Registered at Namecheap.com
Hdsex.tv
Скачать порно видео - парнуха на телефон на hdsex.tv
Hdsex18.com
HD sex videos with nude eighteen year old girls hardly fucked - HDSex18.com
Hdsex18.org
Shared IP
Hdsex18.xxx
HD Sex 18 XXX - Porn Movies, Young Sex Tube, Free XXX Videos

Recently Updated Websites

Nountain.com (3 seconds ago.)Spangledusa.us (4 seconds ago.)Tweed.life (5 seconds ago.)Batterie-marine.com (5 seconds ago.)Ocru.ro (6 seconds ago.)Tokies.com (6 seconds ago.)Robertasnarkus.com (8 seconds ago.)Throughthegarden.com (9 seconds ago.)Odakmuhasebe.com (10 seconds ago.)Athlinablue.com (10 seconds ago.)In-southafricalifeinsurances-ok.live (12 seconds ago.)Beziehungsraeume.de (13 seconds ago.)Thefoodjourney.com (13 seconds ago.)Mytemplatestorage.com (13 seconds ago.)Bachbros.com (14 seconds ago.)Active3d.tech (18 seconds ago.)Eatstinction.com (18 seconds ago.)Abenaboamah.com (20 seconds ago.)Collegevigorbla.com (20 seconds ago.)Canovaproperties.net (20 seconds ago.)Hafequities.com (21 seconds ago.)Mtunderground.com.au (23 seconds ago.)Churchbulletinkc.com (25 seconds ago.)Pinswim.com (25 seconds ago.)Eluminexbio.com (26 seconds ago.)Savyasachiray.com (27 seconds ago.)Austindesigngroup.com (27 seconds ago.)Tacacs.org (28 seconds ago.)Bestme50.com (29 seconds ago.)Restpo.com (29 seconds ago.)

Recently Searched Keywords

《榜样5》:讲述抗疫先锋的故事 (1 second ago.)200px height (1 second ago.)7 925 345 (2 seconds ago.)10px font-family (3 seconds ago.)confirmation email please (6 seconds ago.)thenetaruba (6 seconds ago.)circuito del jarama (7 seconds ago.)клавинова цена (8 seconds ago.)dept. of chemistry (8 seconds ago.)medium black (9 seconds ago.)si6fgko2p4qd--unavailable se7y1sohpre--mobileohpre---typography-8-listtextfontnormal (9 seconds ago.)shuffling (10 seconds ago.)romantic places insider: a romantic getaway out to canada (11 seconds ago.)ampara animal (11 seconds ago.)krisen (12 seconds ago.)lrsquocole (13 seconds ago.)timidly (14 seconds ago.)sự kiện thiên an môn (14 seconds ago.)diody do postojówek białe 20 led smd 5050 w5w (14 seconds ago.)saint croix falls twp (15 seconds ago.)morcheln in english (15 seconds ago.)a faster pathway to medical licensure in other states beginning july 1, 2021 (15 seconds ago.)health-care (16 seconds ago.)ablaufdatum nach (17 seconds ago.)professional plus (18 seconds ago.)nem cua bể (hải phòng) (19 seconds ago.)relief (20 seconds ago.)ffffffcolorrgb59 (21 seconds ago.)0float left-moz-box-sizing border-box-webkit-box-sizing (23 seconds ago.)harbinger gloves india (23 seconds ago.)