American Heart Association | To be a relentless force for a world of longer, healthier lives

Safety: High trust score
Year Founded: 1995
Global Traffic Rank: 1,288
Estimated Worth: $12,476,160
Last updated:2020-11-04
Category: Health

Learn more about the American Heart Association's efforts to reduce death caused by heart disease and stroke. Also learn about cardiovascular conditions, ECC and CPR, donating, heart disease information for healthcare professionals, caregivers, and educators and healthy living


Domain summary

Domain label
heart
Domain extension
org
Domain registered:
1995-12-01
Domain updated:
2020-11-04
Global Traffic Rank
1,288
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$12,476,160
Estimated daily income
$11,552
Estimated monthly income
$351,373

Rank summary

How is heart.org ranked relative to other sites:

Percentage of visits to heart.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Heart.org registered?
A: Heart.org was registered 25 years, 2 months, 3 weeks, 6 days, 18 hours, 52 minutes, 9 seconds ago on Friday, December 1, 1995.
Q: When was the WHOIS for Heart.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 3 days, 18 hours, 52 minutes, 9 seconds ago on Wednesday, November 4, 2020.
Q: What are Heart.org's nameservers?
A: DNS for Heart.org is provided by the following nameservers:
  • dns1.heart.org
  • dns2.heart.org
  • dns3.heart.org
Q: Who is the registrar for the Heart.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Heart.org?
A: Heart.org ranks 1,288 globally on Alexa. Heart.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Heart.org each day?
A: Heart.org receives approximately 1,444,015 visitors and 11,552,120 page impressions per day.
Q: What IP address does Heart.org resolve to?
A: Heart.org resolves to the IPv4 address 12.96.188.30.
Q: In what country are Heart.org servers located in?
A: Heart.org has servers located in the United States.
Q: What webserver software does Heart.org use?
A: Heart.org is powered by webserver.
Q: Who hosts Heart.org?
A: Heart.org is hosted by CJ-CABLENET in United States.
Q: How much is Heart.org worth?
A: Heart.org has an estimated worth of $12,476,160. An average daily income of approximately $11,552, which is roughly $351,373 per month.

Heart.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Heart.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Heart.org

H1 Headings

1 :
  1. Our Hearts are Filled with Gratitude

H2 Headings

23 :
  1. You can save a life
  2. Don't Die of Doubt
  3. We're Made for this Moment
  4. COVID-19 Resources for Everyone
  5. News and Stories
  6. The connection between diabetes, kidney disease and high blood pressure
  7. The connection between diabetes, kidney disease and high blood pressure
  8. After heart valve surgery and heart attack, he came back to 'finish the run'
  9. Heart valve surgery allows New York woman to 'enjoy quality living'
  10. Giving others the platform to soar
  11. Inspiring stories and helpful information from Around the AHA
  12. Featured Videos
  13. Events in Your Area
  14. Discover a Simpler Way to Give
  15. We Still Need Your Help
  16. Volunteer
  17. Hands-Only CPR
  18. Warning Signs
  19. Contact Us
  20. About Us
  21. Get Involved
  22. Our Sites
  23. Speed Bump

H3 Headings

5 :
  1. The Most Important Flu Shot Ever
  2. House Calls: Real Docs, Real Talk - Get Your Flu Shot
  3. Join CycleNation
  4. Jocko Sims demonstrates Hands-Only CPR
  5. A Stroke Survivor Story Michael Johnson

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

51 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

181:

Links - Internal (nofollow)

0:

Links - Outbound

25:

Links - Outbound (nofollow)

0:

Keyword Cloud for Heart.org

volunteer findhealthycreatecprgiftmediaadvised fundwarningpaul dudley whitescientificheart dailyget involved getpolicyadvocatesleephearts5onlyallmemorialwhite legacy societypaul dudleysearchfludocumentaddeventlistenerdomcontentloaded functiondiversityfunctione ifekeycode 32bloodsitesdocumentaddeventlistenerdomcontentloaded function var2legacy societymemorial giftpageopportunitiesredquality32 ekeycodeyourresourcesinternational programscollaborationcenterdailysignsdonor advised fundsociety paul dudleygethealthy living healthyprofessional heart32 ekeycode 13donate nowcardiac arrestlifesavinglovedprofessional heart dailystillhealth topicscardiovascularsaveekeycode 13pressureoptionsworkplace healthfocusableelementsfocusableelementslengthinvolved geteventsheart attackamericanpolicy researchwhiteshopvolunteerlearnoctleteventtargetcanifekeycodegivinghigh blood1ahapaulampget involvedourdudley white legacyvolunteer opportunitiesnewsroommedia newsroomus about usaha financialnewsworkplacewarning signsekeycodeheart failurecardiacliving healthyclosereportpopupinvolvedcontact3donor advisedifekeycode 32epreventdefaultscientific researchstylefinancialdiseaseloved onefitnessaha financial informationfundraisingonearea0legacytrainingprwuireportvarmwatch videostrokehighcontact uswhite legacyheart association9 epreventdefaultcovid19diabetesprofessionaltopics2020 watch videoweyour healthusaddadvisedfunctionehealthcareattackgofailureinvolved get involveddudleyheart valveuiratemake a memorialfind volunteer opportunitiesdocumentaddeventlistenerdomcontentloadedfunctione ifekeycodeinternationalplayblood pressurewomendudley whiteamerican heart association2020 watchwaysresearchmakeways to giveprogramsactiveitembeforeopenpopupfinancial informationhealthcovid19 resourcestruenowassociationhandsonlychallengesociety paulevents in yourfundamerican heartfind volunteerfirstpopupgo redifheart challengevideowatchfunctiontodayinitiativefindinformationwaygivehigh blood pressureyoulivinglifeguidelinesnewyour areahelpdonatevalve4reporthandsonly cprsupportdonorsocietyhealthy livingred for womenheartstroke newsifekeycode 32 ekeycodefunction vararrestmore

Longtail Keyword Density for Heart.org

KeywordsOccurences
american heart association9
ways to give5
healthy living healthy4
high blood pressure4
2020 watch video4
donor advised fund4
documentaddeventlistenerdomcontentloaded function var3
dudley white legacy3
ifekeycode 32 ekeycode3
functione ifekeycode 323
find volunteer opportunities3
events in your3
white legacy society3
make a memorial3
paul dudley white3
society paul dudley3
red for women3
involved get involved3
get involved get3
aha financial information3
us about us3
professional heart daily3
32 ekeycode 133
american heart11
heart association9
heart attack8
donate now6
get involved6
watch video5
contact us4
blood pressure4
go red4
heart challenge4
warning signs4
2020 watch4
donor advised4
advised fund4
high blood4
health topics4
healthy living4
heart valve4
your health4
living healthy4
functione ifekeycode4
ifekeycode 323
hands-only cpr3
your area3
find volunteer3
legacy society3
white legacy3
32 ekeycode3
dudley white3
paul dudley3
ekeycode 133
society paul3
volunteer opportunities3
covid-19 resources3
memorial gift3
stroke news3
documentaddeventlistenerdomcontentloaded function3
function var3
cardiac arrest3
heart failure3
professional heart3
heart daily3
workplace health3
scientific research3
loved one3
aha financial3
financial information3
international programs3
policy research3
media newsroom3
involved get3
volunteer find3
9 epreventdefault3
heart45
rw-ui-report25
your21
health16
stroke16
cpr15
let14
american12
research12
function11
healthy11
us10
volunteer10
find10
association10
information9
policy9
disease9
var9
aha8
get8
red8
08
attack8
18
video7
give7
covid-197
you7
amp7
professional7
support6
our6
add6
now6
donate6
make6
involved6
fund6
resources6
news6
events5
shop5
functione5
opportunities5
society5
if5
gift5
ways5
living5
ekeycode5
can5
cardiac5
watch5
only5
valve5
learn5
all5
new5
ifekeycode5
guidelines5
we5
more4
m4
report4
24
oct4
donor4
center4
help4
way4
training4
advised4
epreventdefault4
signs4
one4
challenge4
warning4
go4
healthcare4
programs4
high4
flu4
diabetes4
topics4
hearts4
life4
blood4
page4
media4
contact4
women4
search4
pressure4
area3
33
failure3
documentaddeventlistenerdomcontentloaded3
focusableelementsfocusableelementslength3
arrest3
hands-only3
closereportpopup3
43
event3
53
sites3
ui3
rate3
style3
fitness3
activeitembeforeopenpopup3
popup3
true3
collaboration3
loved3
still3
first3
memorial3
create3
advocate3
newsroom3
fundraising3
paul3
dudley3
white3
legacy3
international3
financial3
initiative3
diversity3
sleep3
scientific3
options3
lifesaving3
target3
play3
workplace3
cardiovascular3
today3
quality3
daily3
save3
giving3
p3

Who hosts Heart.org?

Heart.org Hosting Provider Information

Hosted IP Address:12.96.188.30
Hosted Hostname:renoheartball.heart.org
Service Provider:CJ-CABLENET
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "CJ-CABLENET" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
CJ-CABLENET
0.0146%

HTTP Header Analysis for Heart.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Content-Length: 40593
Connection: keep-alive
Cache-Control: no-cache, no-store
Pragma: no-cache
Content-Encoding: gzip
Expires: -1
Request-Context: appId=cid-v1:002c9591-340f-426d-8bfe-8202c3df2213
Date: Wed, 04 Nov 2020 01:52:38 GMT
Via: 1.1 lon1-bit23, 1.1 e72282a38ed8303004dbeb48a5b8fbb5.cloudfront.net (CloudFront)
Vary: Accept-Encoding
X-Cache: Miss from cloudfront
X-Amz-Cf-Pop: LHR3-C1
X-Amz-Cf-Id: g9nYsjoDGzsduojh45IMo9jObKGUrWaDLincIrJa2_n7p_3sUpjamQ==

Heart.org Domain Nameserver Information

HostIP AddressCountry
dns1.heart.org 69.152.183.19United States United States
dns2.heart.org 69.152.183.20United States United States
dns3.heart.org 67.18.112.8United States United States


Need to find out who hosts Heart.org?


Domain Registration (WhoIs) information for Heart.org

 Domain Name: HEART.ORG
Registry Domain ID: D848480-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-01-11T08:22:29Z
Creation Date: 1995-01-12T05:00:00Z
Registry Expiry Date: 2030-01-11T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: American Heart Association
Registrant State/Province: TX
Registrant Country: US
Name Server: DNS1.HEART.ORG
Name Server: DNS2.HEART.ORG
Name Server: DNS3.HEART.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-08-11T12:01:57Z

Websites with Similar Names

Heart-2-hand.com
heart-2-hand.com - Registered at Namecheap.com
Heart-2-heart-online.com
Heart-2-Heart-Online.com
Heart-2-heartcpr.com
Heart 2 Heart CPR
Heart-4-dogs.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Heart-academy.com
Default e-commerce 1
Heart-academy.earth
The Heart-Academy

Recently Updated Websites

Sustainablemontreal.ca (3 seconds ago.)Haupia.com (5 seconds ago.)Medcentershealth.com (8 seconds ago.)Successwise.net (10 seconds ago.)Bodiesaz.com (13 seconds ago.)Suckerfish.net (14 seconds ago.)Executivedetailllc.com (15 seconds ago.)Onflow.com (18 seconds ago.)Dtlaglam.com (19 seconds ago.)Okchat.info (19 seconds ago.)Lostgolfballs.co.nz (23 seconds ago.)Txjschool.com (23 seconds ago.)Slickhippie.com (23 seconds ago.)Rpmvending.com (23 seconds ago.)Docusourcellc.com (25 seconds ago.)Influentser.com (27 seconds ago.)Localka.net (27 seconds ago.)Paytunes.org (32 seconds ago.)Ubox.com.hk (35 seconds ago.)Bizstarts.org (39 seconds ago.)Pinks.org (42 seconds ago.)159la.com (48 seconds ago.)Gimagees2.pw (48 seconds ago.)Gilcrestgroup.com (51 seconds ago.)Scicb.com (55 seconds ago.)Indochat.com (55 seconds ago.)Tripsupplies.com (56 seconds ago.)Washiddeninplainsight.com (57 seconds ago.)Markus-lenk.de (58 seconds ago.)Vidtok.ru (59 seconds ago.)

Recently Searched Keywords

パンケーキ レシピ (1 second ago.)atendimento para você e para empresa (5 seconds ago.)please go (7 seconds ago.)fight covid-19 (9 seconds ago.)09 oct (10 seconds ago.)relief valves (12 seconds ago.)egyni (16 seconds ago.)laser hair removal machine (16 seconds ago.)კონტაქტი (17 seconds ago.)united statesoption112inchesoption2150 density (18 seconds ago.)italy 972 israel (18 seconds ago.)page (18 seconds ago.)muere avicii a los 28 años. (19 seconds ago.)offgridmd (20 seconds ago.)mink (22 seconds ago.)ingunenasehoveton (23 seconds ago.)lethal (23 seconds ago.)lue (24 seconds ago.)something went wrong (28 seconds ago.)vancouver bc sectional (28 seconds ago.)color ddd (31 seconds ago.)vi mun t (32 seconds ago.)chả mực bá kiến được làm từ những con mực tươi ngon từ vùng biển vịnh hạ long có chất lượng mực ngon nhất biển của việt nam (32 seconds ago.)electrical accessories (33 seconds ago.)gallery-item-wrapper gallery-item-hover svg (33 seconds ago.)lopen (35 seconds ago.)aname (37 seconds ago.)pantanganasam (37 seconds ago.)sealerssolvent based sealerswater (38 seconds ago.)cinco de mayo (39 seconds ago.)