Hellenism.net Favicon Hellenism.net

Hellenism.net Website Thumbnail
Checking...
Hellenism.Net - Greek culture, info about ancient and modern Greece.
Low trust score
Add a review Change category Claim this site
Discover Greece, learn about the Greek people and their culture. Ancient Greece and Greeks, famous Greeks, mythology, history, philosophy, travel and more.


Domain summary

Domain label
hellenism
Domain extension
net
Domain registered:
1999-02-12
Domain updated:
2020-02-13
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hellenism.net ranked relative to other sites:

Percentage of visits to hellenism.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hellenism.net registered?
A: Hellenism.net was registered 21 years, 8 months, 2 weeks, 21 hours, 35 minutes, 9 seconds ago on Friday, February 12, 1999.
Q: When was the WHOIS for Hellenism.net last updated?
A: The WHOIS entry was last updated 8 months, 1 week, 6 days, 21 hours, 35 minutes, 9 seconds ago on Thursday, February 13, 2020.
Q: What are Hellenism.net's nameservers?
A: DNS for Hellenism.net is provided by the following nameservers:
  • hugh.ns.cloudflare.com
  • zelda.ns.cloudflare.com
Q: Who is the registrar for the Hellenism.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Hellenism.net?
A: Hellenism.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Hellenism.net each day?
A: Hellenism.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hellenism.net resolve to?
A: Hellenism.net resolves to the IPv4 address 173.214.176.83.
Q: In what country are Hellenism.net servers located in?
A: Hellenism.net has servers located in the United States.
Q: What webserver software does Hellenism.net use?
A: Hellenism.net is powered by Apache/2.4.43 webserver.
Q: Who hosts Hellenism.net?
A: Hellenism.net is hosted by RACK59 Partners, LLC in Oklahoma, Edmond, United States, 73083.
Q: How much is Hellenism.net worth?
A: Hellenism.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hellenism.net?

Hellenism.net Hosting Provider Information

Hosted IP Address:173.214.176.83
Hosted Hostname:173.214.176.83
Service Provider:RACK59 Partners, LLC
Hosted Country:United StatesUS
Location Latitude:35.6699
Location Longitude:-97.4647
Webserver Software:Apache/2.4.43

Is "RACK59 Partners, LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Hellenism.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 12 Oct 2020 20:34:44 GMT
Server: Apache/2.4.43
Cache-Control: max-age=3600
Content-Encoding: gzip
WPO-Cache-Status: cached
Content-Security-Policy: upgrade-insecure-requests;
Last-Modified: Mon, 12 Oct 2020 06:01:50 GMT
Expires: Mon, 12 Oct 2020 21:34:44 GMT
Referrer-Policy: no-referrer-when-downgrade
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Hellenism.net Domain Nameserver Information

HostIP AddressCountry
hugh.ns.cloudflare.com 172.64.33.117
zelda.ns.cloudflare.com 173.245.58.242


Need to find out who hosts Hellenism.net?


WhoIs information for Hellenism.net

 Domain Name: HELLENISM.NET
Registry Domain ID: 3599175_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-02-13T19:30:20Z
Creation Date: 1999-02-12T05:00:00Z
Registrar Registration Expiration Date: 2021-02-12T05:00:00Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: Alberta
Registrant Country: CA
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=HELLENISM.NET
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=HELLENISM.NET
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=HELLENISM.NET
Name Server: HUGH.NS.CLOUDFLARE.COM
Name Server: ZELDA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-10-12T20:00:00Z

Hellenism.net Free SEO Report

Website Inpage Analysis for Hellenism.net

H1 Headings

1 :
  1. Discover Greece

H2 Headings

20 :
  1. Welcome to Hellenism.Net
  2. Greek mythology
  3. Greek philosophy, and Greek philosophers
  4. History of ancient Greece, important events
  5. Angelos, Peter
  6. Callas, Maria
  7. Frangoulis, Mario
  8. Stamos, John
  9. Tenet, George
  10. Pilates, Joseph
  11. Alexander the Great
  12. Theodorakis, Mikis
  13. Huffington, Arianna
  14. Chakiris, George
  15. Snyder, Jimmy
  16. Mitropoulos, Dimitri
  17. Connect with Greeks from around the world
  18. Travel to Greece. Experience the Greek islands.
  19. The problem with Greece is that she's just too beautiful...
  20. Stay in touch. Join our community!

H3 Headings

0 :

H4 Headings

4 :
  1. Featured famous Greeks
  2. Famous Greeks
  3. Stay in touch!
  4. Privacy Overview

H5 Headings

14 :
  1. Discover Greece and the Greek culture
  2. Ancient Greek gods, myths, and heroes
  3. Ancient Greek philosophy
  4. Ancient Greece
  5. Hellenism.Net Greek chat
  6. Hellenism.Net Greek forum
  7. Hellenism.Net on Facebook
  8. Hellenism.Net on Twitter
  9. # of Greek islands
  10. 6000
  11. % of fun
  12. 100
  13. Discover Greece
  14. Traveling to Greece

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

134:
  1. No text
    https://hellenism.net
  2. Home
    https://hellenism.net/
  3. All about Greece
    https://hellenism.net/greece/
  4. Facts and Information
    https://hellenism.net/greece/greece-facts-information/
  5. Famous Greeks
    https://hellenism.net/greece/famous-greeks/
  6. Famous Greeks (Alphabetical listing)
    https://hellenism.net/greece/famous-greeks/famous-greeks-alphabetical/
  7. Famous Greeks – Quiz
    https://hellenism.net/famous-greeks-quiz/
  8. Interviews with famous Greeks
    https://hellenism.net/greece/famous-greeks/interviews/
  9. Angelique Rockas
    https://hellenism.net/greece/famous-greeks/interviews/angelique-rockas/
  10. Angelo Tsarouchas
    https://hellenism.net/greece/famous-greeks/interviews/angelo-tsarouchas/
  11. Diamanda Galas
    https://hellenism.net/greece/famous-greeks/interviews/diamanda-galas/
  12. Grace James
    https://hellenism.net/greece/famous-greeks/interviews/grace-james/
  13. Mario Frangoulis
    https://hellenism.net/greece/famous-greeks/interviews/mario-frangoulis/
  14. Stratos Tzortzoglou
    https://hellenism.net/greece/famous-greeks/interviews/stratos-tzortzoglou/
  15. Greek culture
    https://hellenism.net/greece/greek-culture/
  16. People & traditions
    https://hellenism.net/greece/greek-culture/cultural-profile/
  17. Christmas holiday traditions
    https://hellenism.net/greece/greek-culture/cultural-profile/christmas-holiday-traditions/
  18. Clean Monday traditions
    https://hellenism.net/greece/greek-culture/cultural-profile/clean-monday-kathari-deftera-traditions/
  19. Assumption of the Virgin Mary
    https://hellenism.net/greece/greek-culture/cultural-profile/assumption-virgin-mary/
  20. October 28th – The Ohi Day celebration
    https://hellenism.net/greece/greek-culture/cultural-profile/october-28-ohi-day-greece/
  21. Greek language
    https://hellenism.net/greece/greek-culture/greek-language/
  22. The Greek omogenia
    https://hellenism.net/greece/greek-culture/greek-diaspora/
  23. Greek history
    https://hellenism.net/greece/greek-history/
  24. Ancient Greece
    https://hellenism.net/greece/greek-history/ancient-greece/
  25. Byzantine period
    https://hellenism.net/greece/greek-history/byzantine/
  26. Ottoman occupation
    https://hellenism.net/greece/greek-history/ottoman/
  27. Modern Greece
    https://hellenism.net/greece/greek-history/modern-greece/
  28. Greek mythology
    https://hellenism.net/greece/greek-mythology/
  29. The age of gods
    https://hellenism.net/greece/greek-mythology/greek-gods/
  30. The age of myths
    https://hellenism.net/greece/greek-mythology/greek-myths/
  31. Aphrodite and Anchises
    https://hellenism.net/greece/greek-mythology/greek-myths/aphrodite/
  32. Demeter, Persephone, and Hades
    https://hellenism.net/greece/greek-mythology/greek-myths/demetra/
  33. Demeter and Triptolemus
    https://hellenism.net/greece/greek-mythology/greek-myths/triptolemus/
  34. Pentheus and Dionysus
    https://hellenism.net/greece/greek-mythology/greek-myths/pentheus/
  35. Prometheus, Epimetheus and Pandora
    https://hellenism.net/greece/greek-mythology/greek-myths/prometheus/
  36. The age of heroes
    https://hellenism.net/greece/greek-mythology/greek-heroes/
  37. Achilles
    https://hellenism.net/greece/greek-mythology/greek-heroes/achilles/
  38. Agamemnon
    https://hellenism.net/greece/greek-mythology/greek-heroes/agamemnon/
  39. Heracles
    https://hellenism.net/greece/greek-mythology/greek-heroes/heracles/
  40. Jason and the Argonauts
    https://hellenism.net/greece/greek-mythology/greek-heroes/argonauts/
  41. Odysseus
    https://hellenism.net/greece/greek-mythology/greek-heroes/odysseus/
  42. Ancient Greek literature
    https://hellenism.net/greece/ancient-greek-literature/
  43. Aesop’s fables and anecdotes
    https://hellenism.net/greece/ancient-greek-literature/ancient-anecdotes/
  44. Ancient Greek historians
    https://hellenism.net/greece/ancient-greek-literature/greek-historians/
  45. Ancient Greek philosophy
    https://hellenism.net/greece/ancient-greek-literature/greek-philosophers/
  46. Ancient Greek poetry
    https://hellenism.net/greece/ancient-greek-literature/greek-poetry/
  47. Comedy and tragedy
    https://hellenism.net/greece/ancient-greek-literature/comedy-tragedy/
  48. Homer
    https://hellenism.net/greece/ancient-greek-literature/homer/
  49. Modern Greek literature
    https://hellenism.net/greece/modern-greek-literature/
  50. Connect
    https://hellenism.net/connect/
  51. Greek chat
    https://hellenism.net/greek-chat-room/
  52. Hellenism Forum
    https://www.hellenism.net/greek-forum/
  53. Travel
    https://hellenism.net/travel-greece/
  54. history
    https://hellenism.net/greece/greek-culture/greek-diaspora/
  55. traveling to Greece
    https://hellenism.net/travel-greece/
  56. Greek music
    https://www.hellenism.net/greek-forum/
  57. latest news in Greece
    https://www.hellenism.net/greek-forum/
  58. Show Me More!
    http://hellenism.net/greece/
  59. More on Greek mythology!
    http://hellenism.net/greece/greek-mythology/
  60. More on Greek philosophy!
    http://hellenism.net/greece/ancient-greek-literature/greek-philosophers/
  61. More on ancient Greece!
    http://hellenism.net/greece/greek-history/ancient-greece/
  62. Famous Greeks
    https://hellenism.net/category/famous-greeks/
  63. Angelos, Peter
    https://hellenism.net/famous-greeks/angelos-peter/
  64. Callas, Maria
    https://hellenism.net/famous-greeks/maria-callas/
  65. Frangoulis, Mario
    https://hellenism.net/famous-greeks/frangoulis-marios/
  66. Stamos, John
    https://hellenism.net/famous-greeks/stamos-john/
  67. Tenet, George
    https://hellenism.net/famous-greeks/tenet-george/
  68. Pilates, Joseph
    https://hellenism.net/famous-greeks/pilates-joseph/
  69. Alexander the Great
    https://hellenism.net/famous-greeks/alexander-the-great/
  70. Theodorakis, Mikis
    https://hellenism.net/famous-greeks/theodorakis-mikis/
  71. Huffington, Arianna
    https://hellenism.net/famous-greeks/huffington-arianna/
  72. Chakiris, George
    https://hellenism.net/famous-greeks/chakiris-george/
  73. Snyder, Jimmy
    https://hellenism.net/famous-greeks/snyder-jimmy/
  74. Mitropoulos, Dimitri
    https://hellenism.net/famous-greeks/mitropoulos-dimitri/
  75. No text
    http://hellenism.net/greek-chat-room/
  76. Hellenism.Net Greek chat
    https://hellenism.net/greek-chat-room/
  77. Join the Hellenisn.net Greek chat room, one of the oldest Greek chat rooms on the net!
    https://hellenism.net/greek-chat-room/
  78. No text
    https://www.hellenism.net/greek-forum/
  79. Hellenism.Net Greek forum
    https://www.hellenism.net/greek-forum/
  80. Join our famous Greek forum and talk about Greek music, genealogy, travel, and more.
    https://www.hellenism.net/greek-forum/
  81. Learn More
    http://hellenism.net/travel-greece/
  82. travel to Greece
    https://hellenism.net/travel-greece/
  83. traveling to Greece for tips and suggestions
    https://hellenism.net/travel-greece/
  84. reach out to our community
    https://www.hellenism.net/greek-forum/
  85. Lee, Tommy May 6, 2019
    https://hellenism.net/famous-greeks/lee-tommy/
  86. Socrates May 14, 2019
    https://hellenism.net/famous-greeks/socrates/
  87. Wilson, Rita May 16, 2019
    https://hellenism.net/famous-greeks/wilson-rita/
  88. Actors/Actresses
    https://hellenism.net/tag/actors-actresses/
  89. Architects
    https://hellenism.net/tag/architects/
  90. Athletes
    https://hellenism.net/tag/athletes/
  91. Business people
    https://hellenism.net/tag/business-people/
  92. Chefs
    https://hellenism.net/tag/chefs/
  93. Clothes designers
    https://hellenism.net/tag/clothes-designers/
  94. Comedians
    https://hellenism.net/tag/comedians/
  95. Composers
    https://hellenism.net/tag/composers/
  96. Conductors
    https://hellenism.net/tag/conductors/
  97. Dancers
    https://hellenism.net/tag/dancers/
  98. Diplomats
    https://hellenism.net/tag/diplomats/
  99. Directors
    https://hellenism.net/tag/directors/
  100. Engineers
    https://hellenism.net/tag/engineers/
  101. Famous ancient Greeks
    https://hellenism.net/tag/famous-ancient-greeks/
  102. Famous Greeks
    https://hellenism.net/tag/famous-greeks/
  103. Gamblers
    https://hellenism.net/tag/gamblers/
  104. Greek-Americans
    https://hellenism.net/tag/greek-americans/
  105. Inventors
    https://hellenism.net/tag/inventors/
  106. Journalists
    https://hellenism.net/tag/journalists/
  107. Kings/Emperors/Queens
    https://hellenism.net/tag/kings-queens/
  108. Lawyers
    https://hellenism.net/tag/lawyers/
  109. Magicians/Illusionists
    https://hellenism.net/tag/magicians-illusionists/
  110. Mathematicians
    https://hellenism.net/tag/mathematicians/
  111. Musicians
    https://hellenism.net/tag/musicians/
  112. Opera singers
    https://hellenism.net/tag/opera-singers/
  113. Painters
    https://hellenism.net/tag/painters/
  114. Philanthropists
    https://hellenism.net/tag/philanthropists/
  115. Philosophers
    https://hellenism.net/tag/philosophers/
  116. Physical trainer
    https://hellenism.net/tag/physical-trainer/
  117. Physicians
    https://hellenism.net/tag/physicians/
  118. Poets
    https://hellenism.net/tag/poets/
  119. Politicians
    https://hellenism.net/tag/politicians/
  120. Producer
    https://hellenism.net/tag/producer/
  121. Production Designers
    https://hellenism.net/tag/production-designers/
  122. Scientists
    https://hellenism.net/tag/scientists/
  123. Screenwriters
    https://hellenism.net/tag/screenwriters/
  124. Sculptors
    https://hellenism.net/tag/sculptors/
  125. Singers
    https://hellenism.net/tag/singers/
  126. Songwriter
    https://hellenism.net/tag/songwriter/
  127. TV Personalities
    https://hellenism.net/tag/tv-personalities/
  128. Wrestlers
    https://hellenism.net/tag/wrestlers/
  129. Writers
    https://hellenism.net/tag/writers/
  130. About Hellenism.Net
    http://hellenism.net/about-hellenism/
  131. Advertise
    http://hellenism.net/support-hellenism/
  132. Get Involved
    http://hellenism.net/get-involved/
  133. Privacy Policy
    http://hellenism.net/privacy-policy/
  134. Read More
    https://hellenism.net/cookie-policy/

Links - Internal (nofollow)

0:

Links - Outbound

12:
  1. Join us on Facebook
    https://www.facebook.com/Hellenism.net
  2. Join us on Twitter
    https://twitter.com/HellenismNet
  3. No text
    https://twitter.com/HellenismNet
  4. No text
    http://www.facebook.com/Hellenism.net
  5. No text
    https://www.pinterest.ca/hellenismnet/
  6. No text
    https://www.linkedin.com/groups/43140/
  7. Hellenism.Net on Facebook
    http://www.facebook.com/Hellenism.Net
  8. Do you enjoy Hellenism.Net? Then join us on Facebook to keep in touch!
    http://www.facebook.com/Hellenism.Net
  9. No text
    https://twitter.com/#!/HellenismNet
  10. Hellenism.Net on Twitter
    https://twitter.com/#!/HellenismNet
  11. Do you enjoy Hellenism.Net? Then join us on Twitter to keep in touch!
    https://twitter.com/#!/HellenismNet
  12. Esquared
    https://esquaredmedia.com

Links - Outbound (nofollow)

12:
  1. Join us on Facebook
    https://www.facebook.com/Hellenism.net
  2. Join us on Twitter
    https://twitter.com/HellenismNet
  3. No text
    https://twitter.com/HellenismNet
  4. No text
    http://www.facebook.com/Hellenism.net
  5. No text
    https://www.pinterest.ca/hellenismnet/
  6. No text
    https://www.linkedin.com/groups/43140/
  7. Hellenism.Net on Facebook
    http://www.facebook.com/Hellenism.Net
  8. Do you enjoy Hellenism.Net? Then join us on Facebook to keep in touch!
    http://www.facebook.com/Hellenism.Net
  9. No text
    https://twitter.com/#!/HellenismNet
  10. Hellenism.Net on Twitter
    https://twitter.com/#!/HellenismNet
  11. Do you enjoy Hellenism.Net? Then join us on Twitter to keep in touch!
    https://twitter.com/#!/HellenismNet
  12. Esquared
    https://esquaredmedia.com

Keyword Cloud for Hellenism.net

influencefamous greekschatoutusewebsitepolicyancient greeceyourwethesemayourgreek philosophyancientgreecehaveprivacyfamousyoucookiesusphilosophyancientgreeksforumjoinexperiencejoinancient greeksnecessarymosthellenismnetthese cookiesgreekageancientalsojoin us

Longtail Keyword Density for Hellenism.net

KeywordsOccurences
famous greeks12
these cookies6
ancient greece5
greek philosophyancient3
ancient greeks3
join us3
greek33
greeks23
famous17
greece15
cookies14
ancient10
website9
you9
us8
our7
your7
these6
age6
may6
hellenismnet5
necessary4
use4
join4
experience3
also3
most3
forumjoin3
have3
privacy3
philosophyancient3
policy3
chat3
we3
influence3
out3

Hellenism.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hellenism.net is a scam?

Websites with Similar Names

Helle-kleven-shop.com
Helle Kleven Shop
Helle-panke.de
Helle Panke e.V. - Rosa-Luxemburg-Stiftung Berlin
Helle.in
Michael Hellein : Home
Helle.no
Helle Fabrikker - kniv og bestikk
Helleandersen.com
Helle Andersen Hales | Journalist, TV/Radio Host & Voice Over Artist
Helleating.com
Hell Eating And Travel [H.E.A.T.]
Helleb.dk
HelleB.dk

Recently Updated Websites

Elysiandininganddrink.com 2 seconds ago.Thewomantruth.com 2 seconds ago.Belekrentalvilla.com 3 seconds ago.Madebyklara.com 3 seconds ago.Elbarbosa.com 4 seconds ago.Masterevent.pro 4 seconds ago.Pl32.fr 4 seconds ago.Xn--p9j7b3lib2592btden8b6v7br27b.com 5 seconds ago.Skinnywithjenni.com 5 seconds ago.Critiquehouse.com 5 seconds ago.Cashumbrella.com 5 seconds ago.Cadpolska.pl 5 seconds ago.Mundoelectricosh.com 6 seconds ago.Nexusradio.com 6 seconds ago.Pacificwoodcrafters.com 7 seconds ago.Spczernikowo.pl 7 seconds ago.Kipprice.com 7 seconds ago.Rentadeautosdfmexico.com 8 seconds ago.Cranagehaulageltd.com 8 seconds ago.Bozure.com 8 seconds ago.Tanhualuth.com 8 seconds ago.Onlinebizandresources.info 8 seconds ago.Reminderalert.com 9 seconds ago.Clewisdesignstudio.com 9 seconds ago.058lu.com 9 seconds ago.Durhamdalescentre.co.uk 9 seconds ago.Decoestilo.com 9 seconds ago.Liostar.com 10 seconds ago.Virtuallyseen.com 11 seconds ago.Woouf.com 11 seconds ago.