Next Help Information | Next Online Live Chat | Next

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: Unknown
Estimated Worth: $4,941,000
Last updated:2020-10-11
Category: This site has not been categorized yet

Help.next.co.uk is a subdomain of Next.co.uk

Next Online Help - here you'll be able to search our help pages, find quick help links and start a live chat.


Domain summary

Domain label
help.next
Domain extension
co.uk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$4,941,000
Estimated daily income
$4,575
Estimated monthly income
$139,156

Rank summary

How is help.next.co.uk ranked relative to other sites:

Percentage of visits to help.next.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Help.next.co.uk registered?
A: Help.next.co.uk was registered 2021 years, 3 months, 4 days, 6 hours, 50 minutes, 8 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Help.next.co.uk last updated?
A: The WHOIS entry was last updated 2021 years, 3 months, 4 days, 6 hours, 50 minutes, 8 seconds ago on Monday, November 30, -0001.
Q: Who is the registrar for the Help.next.co.uk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Help.next.co.uk?
A: Help.next.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Help.next.co.uk each day?
A: Help.next.co.uk receives approximately 425,064 visitors and 4,574,920 page impressions per day.
Q: What IP address does Help.next.co.uk resolve to?
A: Help.next.co.uk resolves to the IPv4 address 104.66.231.164.
Q: In what country are Help.next.co.uk servers located in?
A: Help.next.co.uk has servers located in the Netherlands.
Q: What webserver software does Help.next.co.uk use?
A: Help.next.co.uk is powered by webserver.
Q: Who hosts Help.next.co.uk?
A: Help.next.co.uk is hosted by Akamai International B.V. in North Holland, Amsterdam, Netherlands, 1000.
Q: How much is Help.next.co.uk worth?
A: Help.next.co.uk has an estimated worth of $4,941,000. An average daily income of approximately $4,575, which is roughly $139,156 per month.

Help.next.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Help.next.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Help.next.co.uk

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 16

H3 Headings

1 :
  1. 0

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

0 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-6544389-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Help.next.co.uk

linksheaderstring14pxwidth100missionblockheader imageblockmission displaychecksecondarydesktopnavigation subdepartmentswidthimgbackgroundpositiondisplay inlineblocknormal100heightarrownew4pxmarginlefttrue varprimarydesktopnavigation0maindesktopnavigation secondarydesktopnavigationmissionmenudetails4px 0norepeat backgroundpositiontextdecorationdefaultundefined16pxprimarynavlinkstextpaddingleftsubdepartments liselectedsansserif fontstyle normalmissionmenulistwebsitesolid d4d4d4leftifcolumnbackgroundimagefunction oniframeloadedmissionmenulist licolhdactivepaddingbottomcatch esetd4d4d4block1px solid d4d4d4nextcoukmissionblockcollectionliselectedazo sansewebsite varblockpositionpageeventtexttransformnonemaindesktopnavigation secondarydesktopnavigationnoneimageblockmission displayprimarydesktopnavigation primarynavlinksinlineblockyoucolumn linksheaderdatalinknamelicolhdactive missionmenudetails missionitemimagecolornavcontent widthisplp7px10px0 4pxsecondarydesktopnavigationrightpaddingtop0maindesktopnavigation primarydesktopnavigationheadingtextnormal fontweight 400sansserif fontstylesecondarydesktopnavigation navcontentcontainersubdepartments lifontstyle normal fontweightlibackgroundf8f8f8padding 0missionblockcollection missionimageblocktitle textalignimportantmaindesktopnavigationnormal fontweightfontsizemarginsecondarydesktopnavigation subdepartments liselectedhdtxtyourliststyleiframesrcscreenprimarynavlinks displaynavcountrytrueautodocument domainsanspointeriframemissionmenudetails missionitemimagefontweightfloatheaderdesktopnavigation navcontent widthheaderdesktopnavigationpaddingrightmargintop 010px 10pxactivelinkheaderdesktopnavigation navcontentmaindesktopnavigationdisplaybackgroundrepeat norepeathasmobmainlinksthentrydisplay blockmissionblockheader imageblockmissionazoonlycenterprimarydesktopnavigation primarynavlinks displayregexcolor111111nonemaindesktopnavigation secondarydesktopnavigation subdepartmentsnavcontentcontainermissionblockdoublesecondarydesktopnavigation subdepartments liprimarydesktopnavigation primarynavlinks primarynavlinkstextusedgetmissionitemimagehereprimarynavlinkssans sansserifframeparameterahoverfavouritesimageblockmissionprimarynavlinks primarynavlinkstextupdatelazyloadexpandmissionblocksinglesolidoniframeloadednamebackgroundrepeat norepeat backgroundpositionnullpaddingprimarynavlinks primarynavlinkstext paddingleftazo sans sansserifflexflexwrapnavcontentsubdepartmentsmaindesktopnavigation primarydesktopnavigation primarynavlinksfontstyleahover textdecorationnonemaindesktopnavigationonly screenlicolhdactive missionmenudetailsmissionimageblocktitle textalign02position1px solidvarfontfamilysansserifdisplay flexflexwrapfontfamily azo sansheightdocumentarticleheightelselicolhdactivesearch10px 0notmarginrightmaindesktopnavigation primarydesktopnavigationbasefontfamily azo10px 10px 0catchmissionimageblocktitle1width 1002pxcursor pointerreachedfontstyle normalmissionblockcollection missionimageblocktitleisdevicetouchenabledprimarynavlinkstext paddingleftbackgroundrepeatmissionblockheader0 0borderbottommargintopazosansfontweight 400flexfontsize14pxidmarginbottomsans sansserif fontstyletextalignrelativezindexmissionmenulist licolhdactive missionmenudetailsreturncursorfalseurldomain0maindesktopnavigationnorepeatmissionblockcollection img1pxfunctiongsecondarydesktopnavigation columnfoundvalue

Longtail Keyword Density for Help.next.co.uk

KeywordsOccurences
maindesktopnavigation primarydesktopnavigation primarynavlinks7
font-style normal font-weight7
primarydesktopnavigation primarynavlinks primarynavlinkstext6
normal font-weight 4006
sans-serif font-style normal5
secondarydesktopnavigation subdepartments li5
mission-menu-list licolhdactive missionmenudetails5
1px solid d4d4d44
primarynavlinks primarynavlinkstext padding-left4
nonemaindesktopnavigation secondarydesktopnavigation subdepartments4
background-repeat no-repeat background-position4
sans sans-serif font-style3
azo sans sans-serif3
font-family azo sans3
primarydesktopnavigation primarynavlinks display3
licolhdactive missionmenudetails mission-item-image3
10px 10px 03
mission-block-header image-block-mission display3
mission-block-collection mission-image-block-title text-align3
headerdesktopnavigation navcontent width3
secondarydesktopnavigation subdepartments liselected3
primarydesktopnavigation primarynavlinks18
secondarydesktopnavigation subdepartments14
1px solid12
mission-menu-list licolhdactive10
secondarydesktopnavigation column9
true var8
maindesktopnavigation primarydesktopnavigation7
font-style normal7
secondarydesktopnavigation navcontentcontainer7
normal font-weight7
primarynavlinks primarynavlinkstext6
solid d4d4d46
font-weight 4006
cursor pointer5
font-family azo5
nonemaindesktopnavigation secondarydesktopnavigation5
licolhdactive missionmenudetails5
0maindesktopnavigation secondarydesktopnavigation5
sans-serif font-style5
subdepartments li5
background-repeat no-repeat5
ahover text-decoration4
primarynavlinkstext padding-left4
mission-block-collection mission-image-block-title4
no-repeat background-position4
missionmenudetails mission-item-image3
website var3
catch e3
azo sans3
width 1003
document domain3
margin-top 03
sans sans-serif3
0 03
subdepartments liselected3
headerdesktopnavigation navcontent3
primarynavlinks display3
0maindesktopnavigation primarydesktopnavigation3
display block3
display inline-block3
column linksheader3
0 4px3
only screen3
navcontent width3
10px 03
display flexflex-wrap3
mission-image-block-title text-align3
mission-block-header image-block-mission3
image-block-mission display3
padding 03
mission-block-collection img3
4px 03
10px 10px3
function oniframeloaded3
var54
secondarydesktopnavigation42
038
if31
primarydesktopnavigation24
display23
true21
solid21
primarynavlinks18
width16
subdepartments15
mission-block-header14
mission-menu-list14
height13
function13
1px13
column11
url11
li11
licolhdactive10
maindesktopnavigation10
0maindesktopnavigation9
padding-left9
padding9
iframe9
return9
16px9
4px8
font-style7
font-family7
font-weight7
padding-top7
text-align7
mission-block-collection7
missionmenudetails7
normal7
10px7
navcontentcontainer7
favourites7
else7
set7
16
check6
isdevicetouchenabled6
color1111116
website6
text-decoration6
d4d4d46
name6
primarynavlinkstext6
25
then5
false5
e5
datalinkname5
null5
try5
margin-top5
padding-right5
nextcouk5
font-size5
nonemaindesktopnavigation5
azo5
azo-sans5
no-repeat5
base5
sans-serif5
color5
cursor5
pointer5
background-repeat5
search5
not5
margin5
you4
none4
backgroundf8f8f84
background-image4
background-position4
nav4
get4
frame4
mobmainlinks4
mission-image-block-title4
img4
ahover4
updatelazyloadexpand4
your4
headerdesktopnavigation4
7px4
blockposition4
left4
margin-left4
float4
flexflex-wrap4
event3
arrow3
font-size14px3
14px3
2px3
importantmaindesktopnavigation3
document3
domain3
100height3
auto3
iframesrc3
country3
string3
id3
margin-right3
used3
new3
page3
has3
oniframeloaded3
articleheight3
regex3
parameter3
value3
liselected3
reached3
isplp3
list-style3
flex3
sans3
width1003
undefined3
activelink3
missionblockdouble3
g3
position3
navcontent3
found3
default3
screen3
catch3
only3
margin-bottom3
mission-item-image3
missionblocksingle3
padding-bottom3
hdtxt3
linksheader3
right3
inline-block3
center3
text-transform3
headingtext3
block3
border-bottom3
relativez-index3
image-block-mission3
here3

Who hosts Help.next.co.uk?

Help.next.co.uk Hosting Provider Information

Hosted IP Address:104.66.231.164
Hosted Hostname:a104-66-231-164.deploy.static.akamaitechnolog
Service Provider:Akamai International B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.35
Location Longitude:4.9167
Webserver Software:Not Applicable

Is "Akamai International B.V." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Akamai International B.V.
0.0158%

HTTP Header Analysis for Help.next.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Location: https://www.next.co.uk/help
Date: Sun, 11 Oct 2020 23:41:57 GMT
Connection: close

Help.next.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Help.next.co.uk?


Domain Registration (WhoIs) information for Help.next.co.uk

 Error for "help.next.co.uk".

This domain cannot be registered because it contravenes the Nominet UK
naming rules. The reason is:
the domain name contains too many parts.

WHOIS lookup made at 02:16:12 27-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Help.aarp
AARP Help
Help.acloud.guru
A Cloud Guru
Help.adobe.com
Adobe Help Center
Help.africa
help.africa -&nbspThis website is for sale! -&nbsphelp Resources and Information.
Help.ahlamontada.com
منتدى مجاني لدعم أحلى المنتديات.
Help.ahrefs.com
Help Center - Ahrefs
Help.alidropship.com
AliDropship Knowledge Base
Help.altervista.org
Altervista Wiki

Recently Updated Websites

Codelysis.com (6 minutes 9 seconds ago.)Autoscrappers.ca (7 minutes 4 seconds ago.)Mycut.me (16 minutes 4 seconds ago.)Newyorklists.com (1 hour 6 seconds ago.)Dogforums.com (1 hour 50 minutes ago.)Mc.uz (1 hour 59 minutes ago.)Telcoict.com.au (2 hours 7 minutes ago.)Slsf.sa (2 hours 17 minutes ago.)Paintaroof.com.au (2 hours 24 minutes ago.)Dmi.nu (2 hours 38 minutes ago.)Pratititech.com (2 hours 50 minutes ago.)Easyaccessap.com (2 hours 57 minutes ago.)Viria.io (2 hours 57 minutes ago.)Yumzyx.com (3 hours 6 minutes ago.)Jira.percona.com (9 hours 34 minutes ago.)Letsenhance.io (10 hours 36 minutes ago.)Publicitarioscriativos.com (10 hours 36 minutes ago.)Cursodereiki.online (10 hours 41 minutes ago.)Vlxx.xyz (10 hours 49 minutes ago.)24sevenjobtalk.com (11 hours 35 minutes ago.)Pipsli.net (11 hours 45 minutes ago.)Forsna.com (12 hours 1 minute ago.)Macnomed.com (12 hours 9 minutes ago.)Easyeducation22.com (12 hours 26 minutes ago.)Fantomcomics.com (12 hours 39 minutes ago.)Naimorrisftlauderdale.com (12 hours 39 minutes ago.)Wrightwritingservices.com (12 hours 39 minutes ago.)Virtualmall.discount (12 hours 39 minutes ago.)Scovills.gs (12 hours 39 minutes ago.)Tenbux.com (12 hours 39 minutes ago.)

Recently Searched Keywords

park (4 seconds ago.)izumi sano hana kimi (4 seconds ago.)530px (8 seconds ago.)x-250 xp thermal imager $2,999.00 $750.00 (10 seconds ago.)etiket rehber (15 seconds ago.)atomic orange (15 seconds ago.)ù…ù†ø§ùø° ùˆù†ù‚ø§ø· ø¨ùŠø¹ ùˆøªø­øµùŠù„ ø§ù„ø®ø¯ù…ø§øª (17 seconds ago.)570pxrec114213755 (18 seconds ago.)print (20 seconds ago.)diorama (21 seconds ago.)tez (29 seconds ago.)р°рісђрµсѓсѓрёрі (32 seconds ago.)og kosovo (33 seconds ago.)ultricies nulla (35 seconds ago.)妻子的味道 (36 seconds ago.)din (38 seconds ago.)border-width 1px td-pulldown-syle-3 (43 seconds ago.)wifi extender (43 seconds ago.)auto 0 autopadding2 (43 seconds ago.)thisconstructorsuperinitializeapplythis bindthis (47 seconds ago.)ø§ù„ø§ø³ø¦ù„ø© ø§ù„ù…øªùƒø±ø±ø© – øªø±ø§ø³ù„ ø§ù„ù…ø¹ø·ùŠø§øª (1 minute 10 seconds ago.)connect (1 minute 15 seconds ago.)评论(144) (1 minute 23 seconds ago.)15px rgba34 25 (1 minute 31 seconds ago.)opinion (1 minute 31 seconds ago.)ø§ù„ø±øµùŠø¯ ø§ù„ù…øªø¨ù‚ùŠ ùŠù…ù† ù†øª (1 minute 35 seconds ago.)tries (1 minute 37 seconds ago.)societal impact – modern technology (1 minute 39 seconds ago.)the benefits of eco-friendly furnished apartments (1 minute 43 seconds ago.)yemen war (1 minute 51 seconds ago.)