Henryranch.net Website Information

Henryranch.net has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 414,271, a Majestic Rank of 0, a Domain Authority of 46% and is not listed in DMOZ.

Henryranch.net is hosted by 1&1 Internet AG in Pennsylvania, Wayne, United States, 19087.
Henryranch.net has an IP Address of 74.208.86.197 and a hostname of perfora.net.

The domain henryranch.net was registered 1 decade 1 year 3 weeks ago by , it was last modified 5 years 4 weeks 2 days ago and currently is set to expire 4 years 4 weeks 2 days ago.


Whois information for henryranch.net

Full Whois Lookup for Henryranch.net Whois Lookup

Domain Name: HENRYRANCH.NET
Registry Domain ID: 1520607565_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.1and1.com
Registrar URL: http://registrar.1and1.info
Updated Date: 2016-09-22T07:38:28Z
Creation Date: 2008-09-21T23:16:51Z
Registry Expiry Date: 2017-09-21T23:16:51Z
Registrar: 1&1 Internet SE
Registrar IANA ID: 83
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6105601459
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS57.1AND1.COM
Name Server: NS58.1AND1.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-01T06:15:43Z

Who hosts Henryranch.net?

Henryranch.net Web Server Information

Hosted IP Address:74.208.86.197
Hosted Hostname:perfora.net
Service Provider:1&1 Internet AG
Hosted Country:United StatesUS
Location Latitude:40.0548
Location Longitude:-75.4083
Webserver Software:Not Applicable

HTTP Header Analysis for Henryranch.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 30 Aug 2015 14:06:59 GMT
Server: Apache
X-Powered-By: PHP/5.5.28
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=3, must-revalidate
WP-Super-Cache: Served supercache file from PHP
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Henryranch.net?

Henryranch.net Free SEO Report

Website Inpage Analysis for Henryranch.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Henryranch.net

ooma teloupgradetutorialwirelesssvnchartcncenhancementposted on januaryannouncekguvd2fixessourcebottle rocketcitizensmarch 29detection libraryx3200issuesallows youcardvia11wordpress pluginincludingsyndicate pressjanuary 18your airsoftstarstrikersearthquake newsgmrs or hamaroundposted on august2010 newsyndicateusingmakegreat dealsdiyreview phpopen flash8around the world23tales from ochervascrivenerworld by installinghttpsyndicatepresshenryranchnetfix the wordpresssqlite3javafastchargerpic programmergreatyou needmintbalanceovente333yet4have notwordpress updatemurspluginsoctobersystemhttphenryranchnetreviewsyerbamatereviewsfrequencybitformattingjulynew articlejoin more thanreleasesif you haveremovenew featurewater heateruploadworldsolarreview linksyshampluginyerba mate reviewsmorenot yetnew reviewusprecision steelairsoftcitizens bandneverhere httphenryranchnetsoftwaresyndicatepressorganicshrimpfatal errorxsg ballistic gogglesplease29usedkguvd2 038 kguvd3ballistic goggleswe haveembeddedbeingfailed wordpress updatecostsqlite3 phptakefeeds syndicate pressfullsocketkendefaultrc airplanewe are pleasednewbaofenghttp socketimageproducts2011 syndicateaddherdreviewpositionperformancevsawesomexcortechserviceelectricalpresshtml table9syndicationshortcodetactical training2017 newubuntufeed aggregationpin adapter cablepoppress users around038php uploadjustfebruaryradio servicetyrmiaseleniumtrainingaggregation plugindon8217tpageopen flash chartuca202websiteallowswordpress joinlinksysadded a newwhilenew versiondesignusboptionsautomated web testingmakingrealwusb100twobutaudiosupermate dc6solar hotbrandcheckmountingkguvd1p kguvd2afterdevelopment toolsxsgposted on julybombilladish airsoftphp sqlitemaysource and freersseveryflashclassgotkguvd2 038weekwolfram and reclaimurltesting with seleniumdetectionaccesswolframreclaim some spacerunninglookworkweb testing038 kguvd3sizingpyramex xsg ballisticgunwithinfrsairplanedigitalchickens back intophp sqlite3ovente electric kettlesystem overviewfeedscience fictionpin2012 syndicate pressavailableairsoft shooting chronographblendmate1 2012 syndicatediy solarcnc toolchainhelper libraryherejoin morearticles tutorialsbest wordpressversion of syndicatejdtmfsyndicate press homepagebest yerba matedishwouxun kguvd1ppostedperspective24 2012yearssome spacetutorialswindowsinstallationmuchlipo batterybest feedposted on decemberphprequestedbl123filtersmemorystrawberry4 pinelectric kettlelotbackfirstyourwithout15pleased to announceadmin pageflashlightbrandsyou canbehringer uca202radiosyerba matedownloadcode19httphenryranchnetsoftwaresyndicatepress7behringerusebeginnersyou are lookinghasposted on novemberlistchronographonesqlite for beginnershave justhot water heaterkguvd1pseries12frs gmrsfeaturesmysyndicate press userslipo battery reviewhave not yetphonewordpress join morebuildbattery reviewlibrarylipo chargerbugfixreleasedbest yerbaup yourhtmljava openupdatedtwo acressyndicate press todayqueryearthquakeequipmentoutrelease of syndicateelectrical noisesqliteloaded2 helperpdoanalogblue lipo batterypress releases28best in airsoftmakesmore informationpanel diygateway for frspop bottle rocketooma reviewlittlewouldrcworkingdroairsoft and tacticalreadcsscontentusing analogvoip phone systemquickhot water 8211seesite24kguvd3frequency listincreasemajorsuchfailed wordpressyour wordpress installationjava dtmfseveral20tacticalwater heater articlebuildingreviewstoolssupportssteviasecuritypress todayover2016 diypanelfree cncbl123 precisionopen sourcepopularmate reviewbottleprecisionfeaturelinkwordpress pluginsairsoft shootingfrs radioverybeen releasednow availablepurchasednoisesource development toolsinto theirtimetriedshooting chronographpagesthroughreducekettleupload managerspacewindows wmihellipgatewayreleased syndicate pressfoundadapterlooking1gogglestarstrikers tyrmiahttpusing analog videopi b usingballisticannounce the releasebluemini latheposted on septemberotherout the newraspberry pi binterpeateryerba mate bombillacontainssciencehenryranchnetdealsnotsoftwareyouairsoft gogglebetauca222game6securepress versionreleased this eveningopenhttpsyndicatepresshenryranchnet posted2managerdynamhellip postedremove wolframextruderminiwordpressfeeds syndicateblue lipoposted on aprilusersbuilding the solarchipsposted on mayb usingfreeshowquery windows wmibest wordpress pluginstraditionalconvertergetxcortech x3200cbteabest feed aggregation2010 syndicateochervapdo sqlite21battery charger reviewjust postedherd chickens backrss feedsigaging droresearchrocketeasygeararticlesbehringer uca222installedheaterhave beenicedsqlite examplebestbandadapter cableraspberryfailedsurejava wmivoip phoneovente electricplugin for wordpresserrorfollowback into theirinstantwould likeenablesdetailsreleased weprojectposted on octobernews feedstodayvisitsimplecontrolstartinginternetcoffeegooddecemberaugustfeed aggregation pluginincludesprovidesectionflash chart 228 2012healthham radiosqlite pdofebruary 28 2012out of memorydc6httphenryranchnetsoftwaresyndicatepress postedraspberry piphp httpchickens backdevelopmentorder2011 syndicate pressoursmallwireless cardintroductionissueback intonowuca202 uca2220pleasedhomepagedirectlyairsoftranchcomgoggle reviewtoneschickenstryversion containsmate reviewssupport172012 syndicaterecovercanenjoy2010 syndicate presssee the syndicatedetails seewordpress installationjanuaryairsoft goggle reviewmissileprogrammerpyramexlinksairsoft propoverviewevermore than2016 diy solaravailable syndicate pressliposoopen source developmentfebruary 28homeif youaggregationcheck outeveningaddedwithout a 4review 8211shootingdtmfmessage22wmiherd chickens26cagedeeplipo battery chargerdonedual1 2012reclaimwatersocket clientnew sitetherewater 8211protectionfunctionkguvd1p kguvd2 038summerclientnomilljava dtmf detectionposted on february10havefeedsgmrsprovidesadminfree cnc toolchainstorefrontlist frsjoinhas beenreview herewifitheirthen youchart 2releaseanalog video withoutaprilbugphp upload managermarchsyndicate press releases13hugetestingpanel diy solarubuntu 1204wordheater articlealongacresrecentlyjava open flashjwmiposted on marchvoip radio gatewayprivacysatelliteradiolatestmany30versionpin adapterdiy solar hotvideonews feedprojectsfollowingautomatedbl123 precision steelneedseptemberbeencharger reviewsaleupdate4 2017fatal2010 new reviewavailable syndicatethen255press the bestarticlenovembersource developmentalsoautomated webyerba mate reviewwemarkettelotoolchainlathepicyour wordpress16igagingfallifgiveb using analogfictionsolar panelapplicationjust gotwe have addedradio privacybatterysupermatechange2 helper library32statuspop bottlewordpress sitemanagementwmi from javait8217ssalantexsg ballistichousecustomvoip radio27radio gateway2011 newmini milltable4 pin adapterpyramex xsgatomsyndicate press versioncupdevicepi bmy reviewtechnologyfixexamplehot waterlightboxlook at mystereotalesfindhas been releasedwouxun kguvd1p kguvd2mate bombillawouxunflash chartsolar hot watermemory errorallyerbakit150cameracompletelywhichhelperthesepress usersinformationbattery chargersteelhave addednew tutorialdtmf detection31machiningphp pdoelectricjava classchart 2 helperuppropfiltertake a looksomefixinganalog to digitaldoes18join usreclaim somephp http socketphone systemintoyour siteanalog videohotvideo withoutyou haveyearlikebwusb100 reviewcablepiinstallingblock2012 newreleased syndicatepress homepageoomathandtmf detection librarygogglesquery windowsnew seriesusers aroundvoip14webnews

Longtail Keyword Density for Henryranch.net

KeywordsOccurences
solar hot water19
syndicate press version17
take a look16
diy solar hot15
posted on february14
posted on january11
posted on november11
posted on december11
posted on march11
2012 syndicate press10
posted on october10
plugin for wordpress9
if you have8
posted on september8
yerba mate review8
posted on july8
you are looking8
hot water heater8
around the world7
press the best6
best feed aggregation6
feed aggregation plugin6
lipo battery charger6
release of syndicate6
join more than6
pop bottle rocket6
out of memory6
wordpress join more5
syndicate press users5
has been released5
press users around5
pyramex xsg ballistic5
raspberry pi b5
posted on august5
announce the release5
posted on may5
world by installing4
pleased to announce4
water heater article4
source and free4
open source development4
released syndicate press4
syndicate press homepage4
2010 syndicate press4
yerba mate reviews4
posted on april4
2011 syndicate press4
xsg ballistic goggles4
see the syndicate4
hot water 82114
we have added4
best yerba mate4
battery charger review4
voip radio gateway4
lipo battery review4
best in airsoft3
your wordpress installation3
2010 new review3
look at my3
airsoft and tactical3
added a new3
1 2012 syndicate3
available syndicate press3
2016 diy solar3
released this evening3
february 28 20123
version of syndicate3
syndicate press today3
we are pleased3
have not yet3
failed wordpress update3
4 pin adapter3
pin adapter cable3
without a 43
analog video without3
using analog video3
airsoft shooting chronograph3
ovente electric kettle3
voip phone system3
blue lipo battery3
analog to digital3
airsoft goggle review3
b using analog3
pi b using3
wouxun kg-uvd1p kg-uvd23
gmrs or ham3
gateway for frs3
dtmf detection library3
kg-uvd1p kg-uvd2 0383
kg-uvd2 038 kg-uvd33
reclaim some space3
wolfram and reclaim3
panel diy solar3
building the solar3
source development tools3
best wordpress plugins3
2 helper library3
sqlite for beginners3
chart 2 helper3
flash chart 23
open flash chart3
fix the wordpress3
java dtmf detection3
syndicate press releases3
feeds syndicate press3
php upload manager3
php http socket3
java open flash3
wmi from java3
bl-123 precision steel3
free cnc toolchain3
yerba mate bombilla3
tales from ocherva3
herd chickens back3
chickens back into3
query windows wmi3
testing with selenium3
automated web testing3
back into their3
out the new3
syndicate press93
hellip posted47
yerba mate37
if you30
solar hot19
hot water19
press version17
new review16
diy solar15
we have12
lipo battery11
you have11
check out10
2012 syndicate10
has been10
open source9
raspberry pi9
mate review8
water heater8
battery charger8
have been7
2011 new7
bottle rocket7
behringer uca2027
wordpress plugin7
pop bottle7
your site7
you need7
ham radio7
your wordpress7
blue lipo7
aggregation plugin7
join more7
more than7
join us7
admin page6
xcortech x32006
wordpress update6
upload manager6
mini mill6
feed aggregation6
review here6
best feed6
new article6
frs radio6
wordpress join6
users around5
ooma telo5
voip radio5
been released5
radio gateway5
charger review5
press users5
pi b5
herd chickens5
airsoft prop5
2010 new5
review 82115
shooting chronograph5
two acres5
pyramex xsg5
xsg ballistic5
new feature4
automated web4
news feed4
more information4
released syndicate4
version contains4
you can4
heater article4
2017 new4
bl-123 precision4
science fiction4
2012 new4
then you4
new tutorial4
just posted4
have added4
news feeds4
best yerba4
php sqlite34
wusb100 review4
wordpress installation4
pdo sqlite4
source development4
phone system4
details see4
battery review4
review php4
cnc toolchain4
goggle review4
ballistic goggles4
press homepage4
would like4
analog video4
mini lathe4
electrical noise4
2011 syndicate4
water 82114
frequency list4
mate reviews4
solar panel4
radio service4
java dtmf4
ovente electric4
just got4
2010 syndicate4
new site4
allows you3
released we3
php sqlite3
sqlite example3
press today3
supermate dc63
java wmi3
sqlite3 php3
behringer uca2223
lipo charger3
sqlite pdo3
php pdo3
httphenryranchnetsoftwaresyndicate-press posted3
tactical training3
available syndicate3
new version3
great deals3
1 20123
28 20123
february 283
your airsoft3
wordpress site3
have just3
rc airplane3
up your3
my review3
here httphenryranchnetsoftwaresyndicate-press3
not yet3
have not3
24 20123
articles tutorials3
http socket3
dish airsoft3
airsoft shooting3
electric kettle3
adapter cable3
pin adapter3
video without3
4 pin3
airsoft goggle3
uca202 uca2223
best wordpress3
wordpress plugins3
starstrikers tyrmia3
development tools3
voip phone3
review linksys3
ooma review3
using analog3
b using3
detection library3
frs gmrs3
wouxun kg-uvd1p3
dtmf detection3
citizens band3
list frs3
radio privacy3
kg-uvd1p kg-uvd23
kg-uvd2 0383
remove wolfram3
reclaim some3
some space3
pic programmer3
panel diy3
038 kg-uvd33
system overview3
mate bombilla3
igaging dro3
socket client3
php upload3
rss feeds3
php http3
failed wordpress3
memory error3
html table3
feeds syndicate3
press releases3
httpsyndicatepresshenryranchnet posted3
january 183
now available3
2016 diy3
new series3
earthquake news3
4 20173
java class3
fatal error3
chickens back3
back into3
into their3
wireless card3
ubuntu 12043
free cnc3
precision steel3
web testing3
query windows3
chart 23
2 helper3
helper library3
flash chart3
open flash3
windows wmi3
java open3
march 293
posted106
review95
syndicate94
press93
you84
new79
wordpress54
hellip47
mate45
version39
your39
yerba38
airsoft37
have36
if33
php31
we31
article30
radio30
feed28
java27
solar26
plugin26
026
126
released26
take25
hot23
out23
great23
best22
more21
release21
site20
220
sqlite20
some20
look20
water19
here19
frs19
has19
tutorial19
lipo18
318
been18
just18
join17
system17
error16
my16
reviews16
can15
not15
diy15
charger15
battery15
update15
ooma14
414
february14
news14
looking14
available14
page14
now13
pdo12
wmi12
simple12
than12
uca20212
open12
all12
airsoftranchcom12
our12
check12
see12
january11
uca22211
small11
ham11
december11
need11
511
into11
march11
using11
november11
privacy11
pi10
source10
mini10
list10
october10
panel10
610
get10
behringer10
admin10
fix9
up9
memory9
may9
voip9
sqlite39
latest9
products9
henryranchnet9
ballistic9
windows9
free9
79
series9
raspberry9
bombilla9
feature9
use9
feeds9
88
july8
library8
recently8
users8
usb8
heater8
web8
bottle8
us8
around8
which8
including8
rss8
aggregation8
september8
easy7
time7
css7
it8217s7
rc7
embedded7
installation7
make7
updated7
then7
manager7
upgrade7
jwmi7
band7
testing7
software7
like7
analog7
blue7
tools7
tactical7
filter7
so7
rocket7
dynam7
pop7
httphenryranchnetsoftwaresyndicate-press7
control7
world7
information7
96
without6
one6
x32006
106
gmrs6
video6
added6
upload6
programmer6
science6
provides6
socket6
http6
got6
chickens6
murs6
xcortech6
but6
two6
mill6
summer6
116
very6
read6
features6
goggle6
beginners6
their6
build6
back6
please6
126
herd6
prop5
dtmf5
0385
url5
earthquake5
today5
cost5
135
sizing5
announce5
first5
working5
via5
gateway5
along5
145
includes5
options5
several5
class5
goggles5
code5
audio5
dc65
automated5
directly5
many5
query5
coffee5
b5
tutorials5
while5
following5
adapter5
august5
market5
development5
phone5
telo5
155
project5
machining5
internet5
space5
contains5
chronograph5
frequency5
shooting5
would5
example5
access5
acres5
xsg5
evening5
pyramex5
reclaim5
change5
image5
ever4
much4
lightbox4
vs4
april4
strawberry4
164
there4
mint4
beta4
shrimp4
chips4
174
baofeng4
salante4
other4
perspective4
awesome4
gear4
allows4
sure4
pleased4
enhancement4
links4
instant4
bit4
brands4
installing4
fixes4
these4
184
website4
full4
homepage4
details4
194
airplane4
installed4
years4
lot4
after4
year4
radios4
such4
articles4
week4
technology4
fiction4
reduce4
bl-1234
wusb1004
health4
real4
mounting4
building4
quick4
projects4
gun4
overview4
remove4
camera4
204
sale4
selenium4
cnc4
table4
html4
within4
lathe4
electrical4
noise4
tyrmia4
client4
position4
equipment4
kit1504
support4
pic4
toolchain4
precision4
follow4
used4
ovente4
service4
supports4
wireless4
electric4
content4
chart4
dish4
satellite4
device4
214
issues4
design4
224
stereo4
enjoy4
converter4
ubuntu4
major4
234
training3
bug3
traditional3
243
253
yet3
263
block3
cage3
cb3
card3
steel3
give3
try3
pages3
section3
completely3
work3
deals3
cable3
iced3
kettle3
security3
digital3
cup3
does3
fall3
stevia3
tones3
function3
game3
supermate3
wi-fi3
syndication3
svn3
missile3
home3
flashlight3
house3
ocherva3
tales3
found3
protection3
igaging3
good3
starstrikers3
plugins3
message3
no3
purchased3
don8217t3
linksys3
pin3
tea3
dro3
wolfram3
show3
273
short-code3
done3
kg-uvd33
kg-uvd1p3
kg-uvd23
283
word3
bug-fix3
running3
deep3
releases3
research3
status3
issue3
enables3
293
wouxun3
over3
custom3
also3
303
citizens3
extruder3
313
link3
dual3
httpsyndicatepresshenryranchnet3
default3
provide3
never3
starting3
interpeater3
through3
add3
jdtmf3
detection3
tried3
organic3
storefront3
fixing3
323
atom3
fatal3
loaded3
being3
application3
management3
formatting3
every3
requested3
flash3
huge3
secure3
introduction3
order3
helper3
ken3
scrivener3
visit3
httphenryranchnetreviewsyerba-mate-reviews3
333
find3
popular3
fast3
brand3
blend3
download3
making3
performance3
makes3
little3
recover3
balance3
increase3
failed3
filters3

What are the nameservers for henryranch.net?

Henryranch.net Domain Nameserver Information

HostIP AddressCountry
ns57.1and1.com 217.160.82.168Germany Germany
ns58.1and1.com 217.160.83.168Germany Germany

Henryranch.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Henryranch.net is a scam?