Hertie.de  |  Hertie - Ihr Online-Kaufhaus für Spielzeug, Technik, Haushalt und Wohnen.
Low trust score  | 
Hertie - Viel Spaß beim Einkaufen. Hertie ist Ihr Online-Shop für Bücher ✔ Haushalt ✔ Spielzeug ✔ Garten & Hobby ✔ und Wohnen ✓auch mit 0 Prozent Finanzierung. Versandkostenfrei bereits ab 20 Euro Bestellwert.




Hertie.de Website Information

Website Ranks & Scores for Hertie.de

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:156,428
Majestic Rank Majestic Rank:715,033
Domain Authority Domain Authority:41%
DMOZ DMOZ Listing:No

Whois information for hertie.de

Full Whois Lookup for Hertie.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Hertie.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: hertie.de
Nserver: ns65.1und1.de
Nserver: ns66.1und1.de
Status: connect
Changed: 2014-12-10T08:37:01+01:00

[Tech-C]
Type: PERSON
Name: Jan Klöker
Organisation: HDK AG
Address: Albert-Brickwedde-Str. 2
PostalCode: 49084
City: Osnabrueck
CountryCode: DE
Phone: +49-541-600660
Fax: +49-541-6006667
Email: Login to show email
2015-05-29T09:01:22+02:00

[Zone-C]
Type: PERSON
Name: Jan Klöker
Organisation: HDK AG
Address: Albert-Brickwedde-Str. 2
PostalCode: 49084
City: Osnabrueck
CountryCode: DE
Phone: +49-541-600660
Fax: +49-541-6006667
Email: Login to show email
2015-05-29T09:01:22+02:00

Who hosts Hertie.de?

Hertie.de is hosted by Telefonica Germany Online Services GmbH in Nordrhein-westfalen, Koeln, Germany, 51147.
Hertie.de has an IP Address of 62.138.110.105 and a hostname of 62.138.110.105 and runs Apache/2.2.15 (Red Hat) web server.



Hertie.de Web Server Information

Hosted IP Address:62.138.110.105
Hosted Hostname:62.138.110.105
Service Provider:Telefonica Germany Online Services GmbH
Hosted Country:GermanyDE
Location Latitude:50.9333
Location Longitude:6.95
Webserver Software:Apache/2.2.15 (Red Hat)

HTTP Header Analysis for Hertie.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 19 Jul 2015 02:42:38 GMT
Server: Apache/2.2.15 (Red Hat)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 12392
Connection: close
Content-Type: text/html; charset=iso-8859-1


Need to find out who hosts Hertie.de?

Hertie.de Free SEO Report

Website Inpage Analysis for Hertie.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hertie.de

inputhobbymusik ampgarten amprecognitionsuchanfragegarten amp hobbyfunctionsichdenvonallespielzeugwiegartenvargeschenkideenhertiesetamp hobbynachwirdmusikhaushaltihrem browserifmsg2innerhtmlbittewohnenbrowserfunctioneventtechnik0hiersieerrorampistnbspdietruemitihremwindowspeechrecognitionnullmsginnerhtml

Longtail Keyword Density for Hertie.de

KeywordsOccurences
garten amp hobby3
amp hobby3
garten amp3
ihrem browser3
musik amp3
amp24
sie13
var12
nbsp9
windowspeechrecognition8
hertie8
recognition7
bitte6
if6
function5
msginnerhtml5
die5
true5
error4
von4
haushalt4
wohnen4
garten4
set4
input4
null4
suchanfrage4
functionevent4
04
ist3
hier3
mit3
nach3
musik3
geschenkideen3
sich3
den3
technik3
browser3
msg2innerhtml3
alle3
hobby3
ihrem3
wird3
spielzeug3
wie3

What are the nameservers for hertie.de?

Hertie.de Domain Nameserver Information

HostIP AddressCountry
ns65.1und1.de 217.160.82.171Germany Germany
ns66.1und1.de 217.160.83.171Germany Germany

Hertie.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hertie.de is a scam?