Hessequa.gov.za Favicon Hessequa.gov.za

Hessequa.gov.za Website Thumbnail
Checking...
Hessequa-Municipality-Home-Page
Low trust score
Add a review Change category Claim this site
Welcome to the official website for the Hessequa region. The region covers Heidelberg, Slangrivier, Riversdal, Albertinia, Gouritsmond & Still Bay


Domain summary

Domain label
hessequa
Domain extension
gov.za
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hessequa.gov.za ranked relative to other sites:

Percentage of visits to hessequa.gov.za from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hessequa.gov.za registered?
A: Hessequa.gov.za was registered 1 week, 3 days, 4 hours, 52 minutes, 27 seconds ago on Friday, October 16, 2020.
Q: When was the WHOIS for Hessequa.gov.za last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 4 hours, 52 minutes, 27 seconds ago on Friday, October 16, 2020.
Q: What are Hessequa.gov.za's nameservers?
A: DNS for Hessequa.gov.za is provided by the following nameservers:
  • ns2.host-h.net
  • ns1.dns-h.com
  • ns1.host-h.net
Q: Who is the registrar for the Hessequa.gov.za domain?
A: The domain has been registered at .
Q: What is the traffic rank for Hessequa.gov.za?
A: Hessequa.gov.za has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hessequa.gov.za each day?
A: Hessequa.gov.za receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hessequa.gov.za resolve to?
A: Hessequa.gov.za resolves to the IPv4 address 85.10.215.58.
Q: In what country are Hessequa.gov.za servers located in?
A: Hessequa.gov.za has servers located in the Germany.
Q: What webserver software does Hessequa.gov.za use?
A: Hessequa.gov.za is powered by Apache webserver.
Q: Who hosts Hessequa.gov.za?
A: Hessequa.gov.za is hosted by Hetzner Online GmbH in Bavaria, Nuremberg, Germany, 90409.
Q: How much is Hessequa.gov.za worth?
A: Hessequa.gov.za has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hessequa.gov.za?

Hessequa.gov.za Hosting Provider Information

Hosted IP Address:85.10.215.58
Hosted Hostname:dedi458.nur4.host-h.net
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:49.4475
Location Longitude:11.0683
Webserver Software:Apache

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Hessequa.gov.za

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 16 Oct 2020 21:03:59 GMT
Server: Apache
X-Frame-Options: SAMEORIGIN
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 25257
Content-Type: text/html; charset=UTF-8

Hessequa.gov.za Domain Nameserver Information

HostIP AddressCountry
ns2.host-h.net 129.232.248.40
ns1.dns-h.com 129.232.248.30
ns1.host-h.net 129.232.248.30


Need to find out who hosts Hessequa.gov.za?


WhoIs information for Hessequa.gov.za

Hessequa.gov.za Free SEO Report

Website Inpage Analysis for Hessequa.gov.za

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

5 :
  1. Recent News
  2. #100 000 Trees Campaign
  3. The Garden Route and Klein Karoo FREE APP
  4. Have your say
  5. Download the FREE load shedding app

H4 Headings

10 :
  1. HESSEQUA MUNICIPALITY HEREBY INVITES THE SUBMISSION OF APPLICATIONS FOR FINANCIAL AND/OR NON-FINANCIAL ASSISTANCE FOR HOSTING AN EVENT/FESTIVAL IN THE 2020/2021 FINANCIAL YEAR, ENDING 30 JUNE 2021.
  2. HESSEQUA MUNICIPALITY INTENTION TO ROLL OUT A COVID-19 BUSINESS RELIEF PROGRAMME.
  3. HESSEQUA THUSONG MOBIELE UITREIK PROGRAM 2020 / 2021
  4. NOTICE: Public Participation Opportunity: 2021/2022 IDP & Budget
  5. KENNISGEWING: Publieke Deelname Geleentheid : 2021/2022 GOP & Begroting
  6. Register SMS Database
  7. EMERGENCY NUMBERS
  8. Fast Links
  9. External Links
  10. Contact us

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

69 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

90:
  1. Staff Login
    http://www.hessequa.gov.za/wp-admin/
  2. No text
    http://www.hessequa.gov.za/
  3. Home
    http://www.hessequa.gov.za/
  4. Executive Mayor
    http://www.hessequa.gov.za/municipal-governance/executive-mayor/
  5. Executive Deputy Mayor
    http://www.hessequa.gov.za/municipal-governance/executive-deputy-mayor/
  6. Office of the Speaker
    http://www.hessequa.gov.za/office-of-the-speaker/
  7. Mayoral Committee
    http://www.hessequa.gov.za/municipal-governance/mayoral-committee/
  8. Council
    http://www.hessequa.gov.za/municipal-governance/council-2/
  9. Council Meeting Videos
    http://www.hessequa.gov.za/council-meeting-videos/
  10. Hessequa Municipal Council
    http://www.hessequa.gov.za/hessequa-municipal-councel/
  11. Councillors Structure Organogram 2019
    http://www.hessequa.gov.za/councillors-structure-organogram-2019/
  12. Wards
    http://www.hessequa.gov.za/municipal-governance/wards/
  13. Municipal Manager
    http://www.hessequa.gov.za/municipal-governance/municipal-manager/
  14. Director: Community Services
    http://www.hessequa.gov.za/municipal-governance/director-community-services/
  15. Director: Corporate Management
    http://www.hessequa.gov.za/municipal-governance/director-corporate-management/
  16. Director: Financial Services
    http://www.hessequa.gov.za/municipal-governance/director-financial-services/
  17. Director: Development Planning
    http://www.hessequa.gov.za/municipal-governance/director-development-planning/
  18. Director: Technical Services
    http://www.hessequa.gov.za/municipal-governance/director-technical-services/
  19. Vision & Mission
    http://www.hessequa.gov.za/municipal-governance/vision-mission/
  20. Organogram
    http://www.hessequa.gov.za/municipal-governance/organogram/
  21. Municipal Properties
    http://www.hessequa.gov.za/municipal-properties/
  22. Potholes
    http://www.hessequa.gov.za/potholes/
  23. Report Hessequa Potholes
    http://www.hessequa.gov.za/municipal-services/report-hessequa-potholes/
  24. Community Services
    http://www.hessequa.gov.za/community-services/
  25. Sport
    http://www.hessequa.gov.za/municipal-services/sport/
  26. Libraries
    http://www.hessequa.gov.za/municipal-services/library/
  27. Youth & Social Development
    http://www.hessequa.gov.za/municipal-services/youth-social-development/
  28. Museums
    http://www.hessequa.gov.za/municipal-services/museums/
  29. Park & Public Spaces
    http://www.hessequa.gov.za/information-center/park-public-spaces/
  30. Protection Services
    http://www.hessequa.gov.za/municipal-services/protection-services/
  31. Traffic Law Enforcement
    http://www.hessequa.gov.za/municipal-services/traffic-department/
  32. Driver’s and Learner Driver’s Licenses & Motor Vehicle Registration / Roadworthy Test
    http://www.hessequa.gov.za/municipal-services/drivers-and-learner-drivers-licenses-2/
  33. Requirements for Application
    http://www.hessequa.gov.za/municipal-services/requirements-for-application/
  34. Fire & Rescue
    http://www.hessequa.gov.za/municipal-services/fire-rescue/
  35. Disaster Management
    http://www.hessequa.gov.za/municipal-services/disaster-management/
  36. Animal Pound
    http://www.hessequa.gov.za/municipal-services/animal-pound/
  37. Electricity and Load Shedding Schedules for the Hessequa Region 2020
    http://www.hessequa.gov.za/municipal-services/electricity/
  38. Water & Sanitation
    http://www.hessequa.gov.za/municipal-services/water-sanitation/
  39. Town Planning & Building
    http://www.hessequa.gov.za/municipal-services/town-planning-building-control/
  40. Waste Management
    http://www.hessequa.gov.za/municipal-services/waste-management/
  41. Recycle Right
    http://www.hessequa.gov.za/municipal-services/recycle/
  42. Local Economic Development
    http://www.hessequa.gov.za/municipal-services/local-economic-development/
  43. Information Centre
    http://www.hessequa.gov.za/information-centre/
  44. Notice Board
    http://www.hessequa.gov.za/information-center/notice-board/
  45. Media
    http://www.hessequa.gov.za/information-center/media/
  46. Newsletter
    http://www.hessequa.gov.za/newsletter/
  47. Press Releases and Media Statements
    http://www.hessequa.gov.za/press-releases-and-media-statements/
  48. Document Library
    http://www.hessequa.gov.za/document-library/
  49. Supply Chain Management
    http://www.hessequa.gov.za/information-center/supply-chain-management/
  50. CENTRAL SUPPLIER DATABASE
    http://www.hessequa.gov.za/information-center/supply-chain-management/central-supplier-database/
  51. Tenders
    http://www.hessequa.gov.za/information-center/tenders/
  52. Awards
    http://www.hessequa.gov.za/information-center/awards/
  53. Awards less the R30 000
    http://www.hessequa.gov.za/information-center/awards-less-the-r30-000/
  54. Tender opening results
    http://www.hessequa.gov.za/information-center/tender-opening-results/
  55. Informal Tenders / Closed Quotations
    http://www.hessequa.gov.za/information-center/informal-tenders-closed-quotations/
  56. Direct Payment Awards
    http://www.hessequa.gov.za/information-center/tenders/direct-payment-awards/
  57. CLOSED QUOTATION OPENING RESULTS
    http://www.hessequa.gov.za/information-center/tenders/closed-quotation-opening-results/
  58. Formal Tenders
    http://www.hessequa.gov.za/information-center/formal-tenders/
  59. SCM Contracts
    http://www.hessequa.gov.za/scm-contracts/
  60. SCM Information & Reports
    http://www.hessequa.gov.za/information-center/tenders/scm-information-reports/
  61. Vacancies
    http://www.hessequa.gov.za/information-center/vacancies/
  62. Forms
    http://www.hessequa.gov.za/information-center/forms/
  63. Stellenbosch University MOU
    http://www.hessequa.gov.za/information-center/stellenbosch-university-mou/
  64. Hessequa Municipality : Corona Virus Information Portal
    http://www.hessequa.gov.za/hessequa-municipality-corona-virus-information-portal/
  65. Contact us
    http://www.hessequa.gov.za/contact-us/
  66. No text
    http://hessequa.gov.za/?print=pdf
  67. No text
    http://hessequa.gov.za/?print=print
  68. STORMSKADE: LAPPIESBAAI DUINE. (Click on photos for detailed information)
    http://www.hessequa.gov.za/wp-content/uploads/2020/08/Persverklaring-Stormskade-Lappiesbaai-duine-Uitgereik-24-Augustus-2020.pdf
  69. No text
    http://www.hessequa.gov.za/hessequa-municipality-hereby-invites-the-submission-of-applications-for-financial-and-or-non-financial-assistance-for-hosting-an-event-festival-in-the-2020-2021-financial-year-ending-30-june-2021/
  70. HESSEQUA MUNICIPALITY HEREBY INVITES THE SUBMISSION OF APPLICATIONS FOR FINANCIAL AND/OR NON-FINANCIAL ASSISTANCE FOR HOSTING AN EVENT/FESTIVAL IN THE 2020/2021 FINANCIAL YEAR, ENDING 30 JUNE 2021.
    http://www.hessequa.gov.za/hessequa-municipality-hereby-invites-the-submission-of-applications-for-financial-and-or-non-financial-assistance-for-hosting-an-event-festival-in-the-2020-2021-financial-year-ending-30-june-2021/
  71. [...]
    http://www.hessequa.gov.za/hessequa-municipality-hereby-invites-the-submission-of-applications-for-financial-and-or-non-financial-assistance-for-hosting-an-event-festival-in-the-2020-2021-financial-year-ending-30-june-2021/
  72. No text
    http://www.hessequa.gov.za/draft-covid-19-business-relief-guidelines-2020/
  73. HESSEQUA MUNICIPALITY INTENTION TO ROLL OUT A COVID-19 BUSINESS RELIEF PROGRAMME.
    http://www.hessequa.gov.za/draft-covid-19-business-relief-guidelines-2020/
  74. [...]
    http://www.hessequa.gov.za/draft-covid-19-business-relief-guidelines-2020/
  75. No text
    http://www.hessequa.gov.za/hessequa-thusong-mobiele-uitreik-program-2020-2021/
  76. HESSEQUA THUSONG MOBIELE UITREIK PROGRAM 2020 / 2021
    http://www.hessequa.gov.za/hessequa-thusong-mobiele-uitreik-program-2020-2021/
  77. [...]
    http://www.hessequa.gov.za/hessequa-thusong-mobiele-uitreik-program-2020-2021/
  78. No text
    http://www.hessequa.gov.za/notice-public-participation-opportunity-2021-2022-idp-budget/
  79. NOTICE: Public Participation Opportunity: 2021/2022 IDP & Budget
    http://www.hessequa.gov.za/notice-public-participation-opportunity-2021-2022-idp-budget/
  80. [...]
    http://www.hessequa.gov.za/notice-public-participation-opportunity-2021-2022-idp-budget/
  81. No text
    http://www.hessequa.gov.za/publieke-deelname-geleentheid-2021-2022-gop-begroting/
  82. KENNISGEWING: Publieke Deelname Geleentheid : 2021/2022 GOP & Begroting
    http://www.hessequa.gov.za/publieke-deelname-geleentheid-2021-2022-gop-begroting/
  83. [...]
    http://www.hessequa.gov.za/publieke-deelname-geleentheid-2021-2022-gop-begroting/
  84. View more articles
    http://www.hessequa.gov.za/news/
  85. No text
    http://www.hessequa.gov.za/wp-content/uploads/2015/06/logo.jpg
  86. No text
    http://www.hessequa.gov.za/wp-content/uploads/2015/06/app.jpg
  87. HM Council Videos
    http://www.hessequa.gov.za/council-meeting-videos/
  88. Draft IDP Review
    http://www.hessequa.gov.za/wp-content/uploads/sp-client-document-manager/24/hm-hessequa-2017-2022-idp-3rd-review-draft-amendment_.pdf
  89. Draft 2020-23 Budget
    http://www.hessequa.gov.za/draft-budget-2020-21/
  90. Draft Budget Files
    http://www.hessequa.gov.za/draft-budget-2020-21/?customize_changeset_uuid=3b361ef2-6639-4c23-b008-8c1da0738795&customize_autosaved=on&customize_messenger_channel=preview-1

Links - Internal (nofollow)

0:

Links - Outbound

17:
  1. No text
    https://af-za.facebook.com/pages/Hessequa-Municipality/158048090915389
  2. Explorers Garden Route Tourism
    http://explorersgardenroute.co.za/
  3. No text
    https://www.westerncape.gov.za/department-of-health/coronavirus
  4. Read More
    http://100000trees.co.za/
  5. DOWNLOAD APP – IOS
    https://itunes.apple.com/us/app/garden-route-and-klein-karoo/id887155275?ls=1&mt=8
  6. DOWNLOAD APP – ANDROID
    https://play.google.com/store/apps/details?id=hr.apps.n207044968&hl=e
  7. No text
    http://www.gardenroutefilmoffice.com
  8. No text
    https://sepush.co.za/
  9. DOWNLOAD APP
    https://sepush.co.za/
  10. > SA Government
    http://www.gov.za/
  11. > Western Cape Government
    https://www.westerncape.gov.za/
  12. > SALGA
    http://www.salga.org.za/
  13. > Eden District Municipality
    http://www.edendm.co.za/
  14. > National Treasury
    http://www.treasury.gov.za/
  15. > Stellenbosch University
    http://www.sun.ac.za/english/
  16. > Municipal Money - A project by National Treasury
    https://municipalmoney.gov.za/profiles/municipality-WC042-hessequa/
  17. Cinnabar Creative Studio
    http://cinnabar.co.za/

Links - Outbound (nofollow)

0:

Keyword Cloud for Hessequa.gov.za

stellenbosch universitylappiesbaai duine clickservicesroutetourism contact uspotholeshomeexplorers gardensheddingstellenboschmayoropeningappphotos for detailedresultsclick on photosdocument libraryvision 038 missionservices directorinformal tenders closedpublicenigemunicipal governanceexecutive mayor038information stormskade lappiesbaaiyour2028713closedinformationtenders closed quotationscentrename038 missionwindowload sheddingclickuniversityvideosmediahessequalappiesbaai duineorganogram3stormskade lappiesbaaiexecutiveussupplyhome municipal governancedepartmenttraffictourism contactstilbaairequireddirectorquotationsdriversformallappiesbaaistormskade lappiesbaai duinephotosnumbermunicipal servicesgovernancedetailedmanager1communityroute tourismdocumentwritewordbusinessinformation stormskadedownloadstormskadeduinevisioncommunity servicesdatabasedocumentreportmissiondetailed information stormskadewatervarplanningformal tendersinformation centreduine clickhome municipalhessequa municipal0councilclosed quotationsregiongtdielibraryopening results000vacancies028hessequa municipalityscmdevelopmentmunicipal managermunicipalexplorers028 713tourismcontactgarden route tourismgrantgarden routevision 038loadgardentenders closedcontact usexplorers garden routeroute tourism contactfunctiondirectdetailed informationinformalmanagementemailmunicipalityfinancialvanawardsinformal tenderstenders

Longtail Keyword Density for Hessequa.gov.za

KeywordsOccurences
stormskade lappiesbaai duine4
lappiesbaai duine click4
click on photos4
photos for detailed4
home municipal governance3
vision 038 mission3
informal tenders closed3
tenders closed quotations3
explorers garden route3
garden route tourism3
route tourism contact3
tourism contact us3
detailed information stormskade3
information stormskade lappiesbaai3
028 7135
contact us5
garden route5
hessequa municipality5
detailed information4
duine click4
community services4
services director4
lappiesbaai duine4
stormskade lappiesbaai4
opening results4
stellenbosch university3
information stormskade3
tourism contact3
route tourism3
explorers garden3
home municipal3
formal tenders3
closed quotations3
municipal governance3
informal tenders3
document library3
information centre3
load shedding3
municipal services3
038 mission3
vision 0383
municipal manager3
hessequa municipal3
executive mayor3
tenders closed3
03817
municipal16
hessequa16
services13
information12
director10
council10
var10
tenders8
management8
required8
municipality7
gt7
06
community6
water6
function6
development6
awards6
us6
contact6
garden5
app5
route5
click5
van5
stilbaai5
0285
closed5
executive5
mayor5
documentwrite4
detailed4
report4
tourism4
potholes4
lappiesbaai4
duine4
photos4
planning4
die4
traffic4
financial4
word4
your4
organogram4
0287134
public4
stormskade4
results4
scm4
drivers4
media4
opening4
supply4
vacancies3
manager3
library3
download3
name3
email3
number3
document3
13
videos3
centre3
23
shedding3
window3
governance3
enige3
department3
business3
mission3
university3
explorers3
formal3
direct3
quotations3
home3
region3
stellenbosch3
informal3
vision3
0003
load3
database3
grant3
33

Hessequa.gov.za Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hessequa.gov.za is a scam?

Websites with Similar Names

Hesse-auktionen.de
Hesse-Auktionen | Moderne Kunst · Bücher · Autographen
Hesse-bub.com
STRATO - Domain reserved
Hesse-bub.info
STRATO - Domain reserved
Hesse-design.net
Offline - Wir sind gleich wieder da
Hesse-grundbesitz.com
Home - Hesse Grundbesitz
Hesse-imex.de
Rainer Hesse - Textile Machinery for embroidery, finishing, knitting, quilting, sewing, spinning and weaving
Hesse-mechatroncis.com
hesse-mechatroncis.com
Hesse-mechatronics.com
Hesse GmbH - weltweit führender Hersteller von Drahtbondern
Hesse-wicker-wedding.com
Danielle Hesse and Michael Wicker's Wedding Website
Hesse.com.cn
404 — Not Found

Recently Updated Websites

Gamebudget.com 2 seconds ago.543021.com 3 seconds ago.Grandmasgreen.com 3 seconds ago.Carvisorsign.com 3 seconds ago.My-europe-visa.com 3 seconds ago.Catalogo.io 3 seconds ago.Xn--12cmal6en9bgdv6evd1bzcyg3ay7fjc.com 4 seconds ago.Lesley-annbrandt.com 4 seconds ago.N-jimu.com 4 seconds ago.Kaiser-eurmark.com 5 seconds ago.Vhb.com 5 seconds ago.Syrl3799.cn 5 seconds ago.Velocitytechsolutions.com 5 seconds ago.Corazondevida.org 5 seconds ago.Letsdothiskingcounty.org 6 seconds ago.Ftenergo.com 6 seconds ago.Novelbright.net 7 seconds ago.Scafidel.com 7 seconds ago.Resitechindustries.com 7 seconds ago.Anyang09.net 8 seconds ago.Montechiaro.net 8 seconds ago.Gestionrisque.com 8 seconds ago.Gatewaylawgroup.com 8 seconds ago.Nocsom.so 9 seconds ago.Lukebryan.com 9 seconds ago.Pizzauno-bg.com 10 seconds ago.Ghitrucking.com 10 seconds ago.Andinovskaiser.com 11 seconds ago.Collingwoodphysio.com 11 seconds ago.Anthemguild.eu 11 seconds ago.