Hicksville Chamber of Commerce – Hicksville, OH

Safety: Low trust score
Year Founded: 2008
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-10-16
Domain label
hicksvillechamber
Domain extension
org
Domain registered:
2008-04-24
Domain updated:
2020-10-16
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hicksvillechamber.org ranked relative to other sites:

Percentage of visits to hicksvillechamber.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hicksvillechamber.org registered?
A: Hicksvillechamber.org was registered 13 years, 2 weeks, 1 day, 8 hours, 12 minutes, 56 seconds ago on Thursday, April 24, 2008.
Q: When was the WHOIS for Hicksvillechamber.org last updated?
A: The WHOIS entry was last updated 6 months, 3 weeks, 3 days, 8 hours, 12 minutes, 56 seconds ago on Friday, October 16, 2020.
Q: What are Hicksvillechamber.org's nameservers?
A: DNS for Hicksvillechamber.org is provided by the following nameservers:
  • ns1.liquidweb.com
  • ns.liquidweb.com
Q: Who is the registrar for the Hicksvillechamber.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Hicksvillechamber.org?
A: Hicksvillechamber.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hicksvillechamber.org each day?
A: Hicksvillechamber.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hicksvillechamber.org resolve to?
A: Hicksvillechamber.org resolves to the IPv4 address 67.227.191.133.
Q: In what country are Hicksvillechamber.org servers located in?
A: Hicksvillechamber.org has servers located in the United States.
Q: What webserver software does Hicksvillechamber.org use?
A: Hicksvillechamber.org is powered by Nginx webserver.
Q: Who hosts Hicksvillechamber.org?
A: Hicksvillechamber.org is hosted by Liquid Web, Inc. in Michigan, Lansing, United States, 48917.
Q: How much is Hicksvillechamber.org worth?
A: Hicksvillechamber.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Hicksvillechamber.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hicksvillechamber.org Free SEO Report

Website Inpage Analysis for Hicksvillechamber.org

H1 Headings

0 :

H2 Headings

1 :
  1. Welcome to The Hicksville Area Chamber of Commerce!

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

64 :
  1. Wise Insurance Agency
  2. Premier Promotional Products and Marketing Solutions
  3. Parkview Physicians Group
  4. Sabre-FWT
  5. Two Bandits Brewing Company
  6. Red Angel Pizza
  7. R Taylor & Cline-Armstrong Insurance
  8. The Country Petal
  9. News Tribune
  10. Crall Ins Services LLC
  11. Your Store, L.L.P.
  12. Hicksville Community Center
  13. Ohio Gas Company
  14. Huber Opera House & Civic Center, Inc
  15. Northwest State Community College
  16. Hicksville Village Schools
  17. Four County Career Center
  18. Hickory Hills
  19. McDonald’s
  20. Sam Switzer Realty
  21. Bruce Guilford Real Estate & Auctioneering
  22. Hicksville Pharmacy & Home Medical LLC
  23. Johnson Memorial Library
  24. Defiance Public Library
  25. Crook-Miller Company
  26. MST, INC
  27. Gordon Creek Granite
  28. APT Manufacturing Solutions
  29. Nemco Food Equipment
  30. Hicksville Family Eye Care LLC
  31. Community Memorial Hospital
  32. Hickory Creek at Hicksville
  33. Trinity Hearing Care
  34. Defiance City Clerk of Courts
  35. Will Power Fitness
  36. Edward Jones
  37. Arc Solutions, Inc.
  38. Gene Smart Community Service Center
  39. NAPA Auto Parts
  40. Expertax, LLC
  41. Luderman & Konst Inc
  42. Sailers
  43. Village of Hicksville
  44. Defiance County Prosecutor’s Office
  45. Defiance County Commissioners
  46. Clerk of Courts
  47. Smith Funeral Home
  48. Slattery Oil Co., Inc.
  49. The Hicksville Bank
  50. Collins and Guilford Wealth Advisors, LLC
  51. Farmers & Merchants State Bank
  52. First Federal Bank
  53. The Wholesale House, Inc.
  54. Jodi Bland Independent Sales Director, Mary Kay Inc.
  55. Defiance County Job & Family Services
  56. Defiance Area Foundation
  57. United Way of Defiance County
  58. Hicksville Historical Society
  59. Community Memorial Hospital Auxiliary-Sunshine Gift Shoppe
  60. Yoder Body Shop
  61. Jim Schmidt Ford
  62. Jim Schmidt Chevrolet, Pontiac, Buick
  63. H & W Automotive Parts
  64. Hicksville Grain

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

84:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hicksvillechamber.org

038chambervarhigh streethicksville ohnbsp43526industrialeventsdrhicksville ohnbsp435260e highhicksville ohnbsp43526high streethicksvillevillageinchttpshicksvillechamberorgwpcontentpluginschamberdashboardbusinessdirectoryimagesmapmarkerpngthecountycommunitysuitestreethicksvilleohnbsp43526whigh001industrial drhicksville ohnbsp43526hicksvilleststreethicksville ohnbsp43526high sthicksvilleeourstatemaincenterhomehttpshicksvillechamberorgwpcontentpluginschamberdashboardbusinessdirectoryimagesmapmarkerpnghicksvilleboxe highhicksvillesthicksville ohnbsp43526llce highe high sthicksvillenewmemorialhicksville ohnbsp43526solutionsdefianceohionbsp43526sthicksvillehighhicksville ohnbsp43526w highnindustrial drhicksvillebankhttpshicksvillechamberorgwpcontentpluginschamberdashboardbusinessdirectoryimagesmapmarkerpngdefiancehttpshicksvillechamberorgwpcontentpluginschamberdashboardbusinessdirectoryimagesmapmarkerpngdefiance countydrhicksvilleohnbsp43512mapcompanyhigh sthicksville ohnbsp43526highhicksvillew high sthicksvillemarker

Longtail Keyword Density for Hicksvillechamber.org

KeywordsOccurences
high sthicksville ohnbsp4352616
e high sthicksville12
w high sthicksville6
high streethicksville ohnbsp435263
e highhicksville ohnbsp435263
industrial drhicksville ohnbsp435263
sthicksville ohnbsp4352622
high sthicksville18
e high17
w high9
streethicksville ohnbsp435265
high streethicksville4
highhicksville ohnbsp435264
hicksville ohnbsp435263
e highhicksville3
industrial drhicksville3
drhicksville ohnbsp435263
httpshicksvillechamberorgwp-contentpluginschamber-dashboard-business-directoryimagesmapmarkerpngdefiance county3
ohnbsp4352645
high28
sthicksville24
e20
w12
hicksville10
03810
ohnbsp435129
var8
new7
inc7
our6
streethicksville6
httpshicksvillechamberorgwp-contentpluginschamber-dashboard-business-directoryimagesmapmarkerpnghicksville6
httpshicksvillechamberorgwp-contentpluginschamber-dashboard-business-directoryimagesmapmarkerpngdefiance6
highhicksville5
05
community5
st5
n5
ohionbsp435265
box5
county5
llc5
0014
center4
chamber4
marker4
events4
bank3
suite3
main3
map3
home3
drhicksville3
industrial3
defiance3
memorial3
state3
company3
solutions3
village3
httpshicksvillechamberorgwp-contentpluginschamber-dashboard-business-directoryimagesmapmarkerpngthe3

Who hosts Hicksvillechamber.org?

Hicksvillechamber.org Hosting Provider Information

Hosted IP Address:67.227.191.133
Hosted Hostname:67.227.191.133
Service Provider:Liquid Web, Inc.
Hosted Country:United StatesUS
Location Latitude:42.7348
Location Longitude:-84.6245
Webserver Software:nginx

Is "Liquid Web, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
Liquid Web, Inc.
0.6648%

HTTP Header Analysis for Hicksvillechamber.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Fri, 16 Oct 2020 08:40:38 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Keep-Alive: timeout=20
Location: https://hicksvillechamber.org/
Expires: Fri, 16 Oct 2020 08:40:48 GMT
Cache-Control: max-age=10

Hicksvillechamber.org Domain Nameserver Information

HostIP AddressCountry
ns1.liquidweb.com 69.16.223.254
ns.liquidweb.com 69.16.222.254


Need to find out who hosts Hicksvillechamber.org?


Domain Registration (WhoIs) information for Hicksvillechamber.org

 Domain Name: HICKSVILLECHAMBER.ORG
Registry Domain ID: D152526501-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-04-29T17:22:05Z
Creation Date: 2008-04-24T03:03:16Z
Registry Expiry Date: 2021-04-24T03:03:16Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Amanda Krill Media
Registrant State/Province: Ohio
Registrant Country: US
Name Server: NS.LIQUIDWEB.COM
Name Server: NS1.LIQUIDWEB.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-15T11:29:19Z

Websites with Similar Names

Hicks-co.com
Hicks Company Commercial Real Estate
Hicks-electronics.com
HICKS ELECTRONICS - Home
Hicks-jenkins.com
Clive Hicks-JenkinsClive Hicks-Jenkins
Hicks-merrill-wedding.com
Olivia Merrill & Alicia Hicks - Wedding Website - Wedding on 10/02/2021
Hicks-ronsick.com
Namecheap Parking Page
Hicks-trust.org
hicks-trust.org -&nbsphicks trust Resources and Information.
Hicks.cam
hicks.cam - Registered at Namecheap.com

Recently Updated Websites

Merrchx.com (1 second ago.)Ketaminesavedme.com (2 seconds ago.)Yibovip8772.com (3 seconds ago.)Thedirtybru.com (4 seconds ago.)Foofn.com (5 seconds ago.)Kids-amazon.com (5 seconds ago.)Nutripacks.net (5 seconds ago.)Ezratechnologies.com (5 seconds ago.)Obao828.vip (6 seconds ago.)European-travel-zone.net (6 seconds ago.)Nativodesign.biz (7 seconds ago.)Hyperenergydrinks.net (7 seconds ago.)Treaty.one (7 seconds ago.)Masaj-erotic.sex (7 seconds ago.)Orchidscapes.com (7 seconds ago.)Tonypamment.com (8 seconds ago.)Loveyoulikeasister.org (8 seconds ago.)Sebastianbieniek.com (8 seconds ago.)Dalwhinniedelivers.com (9 seconds ago.)Thepelvicptdoulas.org (9 seconds ago.)Bailemiaomu.com (10 seconds ago.)Reilifestyler.com (10 seconds ago.)Zenfinexpro.com (10 seconds ago.)Searchstrategic.com (10 seconds ago.)Tiktoksupplier.com (10 seconds ago.)Isioo.com (10 seconds ago.)Pecvial.com (11 seconds ago.)Japansailingclub.com (11 seconds ago.)Cowlitzschool.org (11 seconds ago.)Rookiemaker.net (11 seconds ago.)

Recently Searched Keywords

contentlist216217contentlist2 (1 second ago.)streamable (2 seconds ago.)may 18, 2020 (3 seconds ago.)microsoft dynamics 365: powerapps component framework: part-1 (intro)microsoft recently released pcf for ga(general availability). this will enable developers to create field level or grid (7 seconds ago.)wellness pentru (8 seconds ago.)advokatas a.barčius : plūsta laiškai ir informacija apie tai, kad kauno „ daktaras“ galėjo nužudyti mažiau asmenų komentarų: 1 (8 seconds ago.)обувь nike оптом (9 seconds ago.)những món ăn từ cà chua tuyệt vời giúp làm đẹp cho làn da (9 seconds ago.)вызвали домой брюнетку и трахнули ее толпой (10 seconds ago.)trivia & quizzes (12 seconds ago.)sublimera votre (12 seconds ago.)kbrs night club (13 seconds ago.)wijkwandelingen (13 seconds ago.)gdzie kupić czekoladę (14 seconds ago.)port alberni  (15 seconds ago.)laredo, (15 seconds ago.)my mate nate x kitolab (16 seconds ago.)watch top games (16 seconds ago.)jigya asansol c (17 seconds ago.)iqac anual report 2011 -12 (17 seconds ago.)skylerjohnson (18 seconds ago.)li anh ch (21 seconds ago.)agama zoe abas (21 seconds ago.)egypt mom (24 seconds ago.)0px 42px (25 seconds ago.)verb examples (26 seconds ago.)illustrator g f (26 seconds ago.)@metsatseura (27 seconds ago.)优秀女优赏女神北川瞳美乳丰臀淫乱学妹2020-12-25 (27 seconds ago.)masaj (27 seconds ago.)