Hkgt.de  |  Waren online im Shop kaufen vom Handels-Kontor Gebr. Tjarks GbR - Handels-Kontor Gebr. Tjarks GbR
Low trust score  | 
Willkommen im Shop vom Handels-Kontor Gebr. Tjarks - Ihr Schlüssel zu Tauen, Pfadfinder und Outdoorbedarf! Kaufen Sie online im Shop Messer, Zelte, Tauwerk, Jurten, Kohten, Pfadfinderbedarf...

Hkgt.de Website Information

Hkgt.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 553,845, a Majestic Rank of 0, a Domain Authority of 25% and is not listed in DMOZ.

Hkgt.de is hosted by STRATO AG in Mecklenburg-vorpommern, Marsow, Germany, 19260.
Hkgt.de has an IP Address of 81.169.145.158 and a hostname of w9e.rzone.de and runs Apache/2.2.29 (Unix) web server.

The domain hkgt.de was registered 201 decades 8 years 9 months ago by , it was last modified 1 decade 2 years 7 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for hkgt.de

Full Whois Lookup for Hkgt.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: hkgt.de
Nserver: docks11.rzone.de
Nserver: shades11.rzone.de
Status: connect
Changed: 2008-04-07T16:34:42+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster STRATO AG Webhosting
Organisation: STRATO AG
Address: Pascalstraße 10
PostalCode: 10587
City: Berlin
CountryCode: DE
Phone: +49 30886150
Fax: +49 3088615111
Email: Login to show email
2006-12-04T23:27:06+01:00

[Zone-C]
Type: ROLE
Name: Zonemaster STRATO AG Webhosting
Organisation: STRATO AG
Address: Pascalstraße 10
PostalCode: 10587
City: Berlin
CountryCode: DE
Phone: +49 30886150
Fax: +49 3088615111
Email: Login to show email
2006-12-05T00:35:07+01:00

Who hosts Hkgt.de?

Hkgt.de Web Server Information

Hosted IP Address:81.169.145.158
Hosted Hostname:w9e.rzone.de
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:53.4244
Location Longitude:10.9316
Webserver Software:Apache/2.2.29 (Unix)

HTTP Header Analysis for Hkgt.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 10 Sep 2015 05:37:50 GMT
Server: Apache/2.2.29 (Unix)
Last-Modified: Mon, 07 Sep 2015 22:33:54 GMT
ETag: "9cc2c03-1291d-51f2fd8285880"
Accept-Ranges: bytes
Content-Length: 76061
Content-Type: text/html


Need to find out who hosts Hkgt.de?

Hkgt.de Free SEO Report

Website Inpage Analysis for Hkgt.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hkgt.de

hostfix true clicksmproduct nullhandleboxoffset 0 handlecornerspositionsmallicons falsehostfix trueinside offsetpnlquantitysmartform handlebox falsealignelemsperrow toboolwahr19zzgl versandmehr detailssmproductselffindprnowpricehtmlcprimaryformatsmproductlistidgetprice smcashtmlsexpreplacesug cprimaryformattransvalue smcsymbolversandmehr detailssmproductiftoboolfalsch toboolwahrwerktageninklalignelemstogrid toboolwahr alignelemsperrowtrue clicktransporthintdatavalue iftransvalue varfixed isscrollablevar btnmwst 19zzglvar smproductlist ifsmproductnullfarsize 28toboolwahr alignelemsperrowselffindprsecpricehtmlcsecondaryformatsmproductlistidgetprice smcgroup smcsymbolsbscrollbutton nearsize 96selffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroup smcsymboljquerythis var idaddclassuicornerallvar id parseintselfdatapkidcm gesamtlnge96 farsize0 handlecornersschwarzinkloffsetvar smproduct nullsbscrollbuttonifsmproductnull var smproducttransvalue transporthintdatavaluenearsize 96 farsizesmcsymbol selffindprnowpricehtmlcprimaryformatsmproductlistidgetpricealignelemsperrownbsphostfixmwst 19zzgl versandmehrpricing selffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalpricefalse hostfixvar smproductlistca 100aus13 werktagenmehrsmcsymbol selffindprsecpricehtmlcsecondaryformatsmproductlistidgetpriceiftransvalue varformatproductbasepricesmproductlistid var transporthintautoposition true positiontransporthintdatavalue iftransvaluefixed isscrollable toboolfalschmorapnlquantitysmartform handleboxhandlelabel falsetexpshipsurchargeinfo sexp sexpreplacesugtransvalue transporthintdatavalue iftransvaluesexp texpshipsurchargeinfo sexpself jquerythisfunctiondirtransporthinttoboolwahrarbeitsmessergridstyle fixedsmcgroup smcsymboliftransvaluefunctiondir varsmcsymbol smcgroupsmcgroup smcsymbol selffindprnowpricehtmlcprimaryformatsmproductlistidgetpricesmcsymbol selffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalpricetrue click functiondirjetztsmproductlist ifsmproductnullcprimaryformattransvalue smcsymbol smcgroupbtngesamtlngeclick functiondir varselffindprpangvhtmlel100 cmselffindprsecpricehtmlcsecondaryformatsmproductlistidgetpriceselffindprnowpricehtmlcprimaryformatsmproductlistidgetpriceplcelleachfunctionwerktagenmehrshowbuttonalwaysfalseshowbuttonalways truewerktageninkl mwsteldatascrollbutton addclassuicorneralldetailslieferzeitnbsplieferbarsmcsymbol selffindprpangvhtmlformatproductbasepricesmproductlistidself jquerythis varproductcm gesamtlnge catrue smallicons11smproductsetattributesmathumbselffindprtransphintclickjquerythis varnull smproductselffindprpangvhtml formatproductbasepricesmproductlistid varpricingtrue autoposition true13 werktageninklfunctionifsmproductnulltransporthinthtmlsexpselffindprpangvhtml formatproductbasepricesmproductlistidpricing selffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroupgesamtlnge caeach productfunctiondir var el110smproductsetattributesmathumbselffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalpricesexptexpshipsurchargeinfofalse hostfix truegrifflngecm grifflnge caparseintselfdatapkid pricing selffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalpricesexp sexpreplacesugtargetsexp sexpreplacesug cprimaryformattransvaluesmproductlisttrue autopositionselffindprtransphint transvalue transporthintdatavalue13 werktagensmproductfarsize3nearsizesmcgroup transporthinthtmlsexpsmproductlistidgetprice smcgroupsmproductalignelemstogrid toboolwahrhandlebox false handlelabelmesserbtn eldatascrollbutton addclassuicornerallsexpreplacesug cprimaryformattransvalue2cm19zzglcprimaryformattransvalue smcsymbolselfcm grifflngeclick functiondirsmproductlistidgetpriceschwarzinkl mwstjquerythissexpreplacesugfarsize 28 targetschwarzinkl mwst 19zzglwerktageninkl mwst 19zzglselffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroupautopositionvar self jquerythisifsmproductlistnull var smproductlisthandlecorners true smalliconstrue positionsmcsymbolplcelleachfunction varsmcsymbol selffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetpriceformatproductbasepricesmproductlistid vartoboolfalschvar btn eldatascrollbuttonifsmproductlistnull119zzgl versandmehr detailslieferzeitnbsplieferbariftoboolfalschselffindprprepricehtmlcprimaryformatsmproductlistidgetoriginalprice13 werktageninkl mwstselffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetpricesmcsymbol selffindprnowpricehtmlcprimaryformatsmproductlistidgetprice smcashtmlsmcgroupsexp texpshipsurchargeinfoisscrollable100 cm grifflngemwstdetailslieferzeitnbsplieferbar in 13eldatascrollbuttondetailssmproductsbscrollbutton nearsizeversandmehrhandlebox falsegridstyleposition inside28 targethandlecorners true96 farsize 28selffindprtransphint transvaluevar sexp texpshipsurchargeinfopnlquantitysmartformcainsidevar transporthint selffindprtransphintfalse handlelabel falsemesser moragrifflnge caeachwerktagensmproducttransporthint selffindprtransphintsmcgroup smcsymbol selffindprpangvhtmlsmcsymbol smcgroup transporthinthtmlsexptoboolfalsch forcegridfixedforcegridimagealignmit0parseintselfdatapkidoffset 0el this varisscrollable toboolfalschsmcgroup smcsymbol selffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalpricesmcashtml smcgroup smcsymboltoboolwahr imagealignnearsize 96selffindprsavepricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetprice smcgroupjquerywindowloadfunctionsmcgroup smcsymbol selffindprsecpricehtmlcsecondaryformatsmproductlistidgetpricesmalliconssmcashtml smcgroupsmproductlist ifsmproductnull varwerktagenmehr detailssmproductselffindprnowpricehtmlcprimaryformatsmproductlistidgetprice smcashtml smcgroupifsmproductlistnull varvar selffalse handlelabelsmcsymbol selffindprsecpricehtmlcsecondaryformatsmproductlistidgetprice smcgroupwarenkorbalignelemstogridversandmehr detailslieferzeitnbsplieferbarcprimaryformattransvaluetrueparseintselfdatapkid pricingtransporthint selffindprtransphint transvalueiftransvalue var sexpalignelemsperrow toboolwahr imagealignifsmproductnull varinside offset 0handlecorners0 handlecorners trueca 100 cmsmproduct null smproduct13 werktagenmehr detailssmproducttrue smallicons falseid parseintselfdatapkid pricingisscrollable toboolfalsch forcegridtexpshipsurchargeinfo sexpsmcsymbol selffindprpangvhtml formatproductbasepricesmproductlistidvarid parseintselfdatapkidtoboolwahr alignelemsperrow toboolwahr13smallicons false hostfixnbsp nbspselffindprsecpricehtmlcsecondaryformatsmproductlistidgetprice smcgroupvar transporthintautoposition true19zzgl versandmehr4produktetrue position insidenullvar sexpplcelleachfunction var selftransvaluevar idminibaskettransporthintdatavaluevar smproductidgridstyle fixed isscrollablesmcashtmlshowbuttonalways true autopositionsmproductlistidgetprice smcgroup smcsymbolposition inside offsetvar elbtn eldatascrollbuttonhandlelabel

Longtail Keyword Density for Hkgt.de

KeywordsOccurences
mwst 19zzgl versandmehr15
19zzgl versandmehr detailslieferzeitnbsplieferbar11
detailslieferzeitnbsplieferbar in 1-311
cm grifflnge ca7
cm gesamtlnge ca6
werktageninkl mwst 19zzgl4
1-3 werktageninkl mwst4
ca 100 cm4
toboolwahr alignelemsperrow toboolwahr3
nearsize 96 farsize3
alignelemsperrow toboolwahr imagealign3
96 farsize 283
fixed isscrollable toboolfalsch3
alignelemstogrid toboolwahr alignelemsperrow3
isscrollable toboolfalsch forcegrid3
gridstyle fixed isscrollable3
sbscrollbutton nearsize 963
pnl-quantitysmartform handlebox false3
sexp sexpreplacesug cprimaryformattransvalue3
texpship-surcharge-info sexp sexpreplacesug3
sexp texpship-surcharge-info sexp3
sexpreplacesug cprimaryformattransvalue smcsymbol3
cprimaryformattransvalue smcsymbol smcgroup3
handlebox false handlelabel3
farsize 28 target3
smcsymbol smcgroup transporthinthtmlsexp3
false handlelabel false3
position inside offset3
true click functiondir3
hostfix true click3
false hostfix true3
click functiondir var3
functiondir var el3
btn eldatascrollbutton addclassui-corner-all3
var btn eldatascrollbutton3
el this var3
smallicons false hostfix3
true smallicons false3
true position inside3
autoposition true position3
true autoposition true3
var sexp texpship-surcharge-info3
inside offset 03
handlecorners true smallicons3
0 handlecorners true3
offset 0 handlecorners3
showbuttonalways true autoposition3
transporthint selffindpr-transp-hint transvalue3
jquerythis var id3
self jquerythis var3
var self jquerythis3
var id parseintselfdatapkid3
id parseintselfdatapkid pricing3
selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroup smcsymbol3
pricing selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroup3
parseintselfdatapkid pricing selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
pl-celleachfunction var self3
schwarzinkl mwst 19zzgl3
ifsmproductnull var smproduct3
smproductlist ifsmproductnull var3
var smproductlist ifsmproductnull3
var smproduct null3
smproduct null smproduct3
1-3 werktagenmehr detailssmproduct3
19zzgl versandmehr detailssmproduct3
100 cm grifflnge3
smcgroup smcsymbol selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice3
smcsymbol selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice smcashtml3
formatproductbasepricesmproductlistid var transporthint3
selffindpr-pangvhtml formatproductbasepricesmproductlistid var3
smcsymbol selffindpr-pangvhtml formatproductbasepricesmproductlistid3
var transporthint selffindpr-transp-hint3
ifsmproductlistnull var smproductlist3
transporthintdatavalue iftransvalue var3
transvalue transporthintdatavalue iftransvalue3
selffindpr-transp-hint transvalue transporthintdatavalue3
smcgroup smcsymbol selffindpr-pangvhtml3
smproductlistidgetprice smcgroup smcsymbol3
smcgroup smcsymbol selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice3
smcashtml smcgroup smcsymbol3
selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice smcashtml smcgroup3
smcsymbol selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice smcgroup3
selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice smcgroup smcsymbol3
selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetprice smcgroup3
smcsymbol selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetprice3
smcgroup smcsymbol selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
iftransvalue var sexp3
19zzgl versandmehr15
mwst 19zzgl15
smcgroup smcsymbol12
versandmehr detailslieferzeitnbsplieferbar11
1-3 werktagensmproduct10
cm grifflnge7
grifflnge ca7
gesamtlnge ca6
cm gesamtlnge6
1-3 werktagenmehr4
100 cm4
werktageninkl mwst4
ca 1004
1-3 werktageninkl4
fixed isscrollable3
96 farsize3
gridstyle fixed3
farsize 283
nearsize 963
iftoboolfalsch toboolwahr3
toboolwahr imagealign3
sbscrollbutton nearsize3
toboolfalsch forcegrid3
isscrollable toboolfalsch3
cprimaryformattransvalue smcsymbol3
handlebox false3
pnl-quantitysmartform handlebox3
smcgroup transporthinthtmlsexp3
false handlelabel3
handlelabel false3
toboolwahr alignelemsperrow3
alignelemstogrid toboolwahr3
smcsymbol smcgroup3
alignelemsperrow toboolwahr3
offset 03
click functiondir3
true click3
hostfix true3
false hostfix3
functiondir var3
var el3
eldatascrollbutton addclassui-corner-all3
btn eldatascrollbutton3
var btn3
smallicons false3
true smallicons3
true position3
autoposition true3
true autoposition3
showbuttonalways true3
position inside3
inside offset3
handlecorners true3
0 handlecorners3
sexpreplacesug cprimaryformattransvalue3
28 target3
selffindpr-transp-hint transvalue3
self jquerythis3
var self3
pl-celleachfunction var3
each product3
jquerythis var3
var id3
pricing selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
parseintselfdatapkid pricing3
id parseintselfdatapkid3
nbsp nbsp3
schwarzinkl mwst3
var smproduct3
ifsmproductnull var3
smproductlist ifsmproductnull3
var smproductlist3
smproduct null3
null smproduct3
werktagenmehr detailssmproduct3
versandmehr detailssmproduct3
messer mora3
selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smcgroup3
smcsymbol selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice3
transvalue transporthintdatavalue3
ifsmproductlistnull var3
transporthint selffindpr-transp-hint3
var transporthint3
transporthintdatavalue iftransvalue3
iftransvalue var3
texpship-surcharge-info sexp3
sexp texpship-surcharge-info3
var sexp3
formatproductbasepricesmproductlistid var3
selffindpr-pangvhtml formatproductbasepricesmproductlistid3
smcsymbol selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice3
smcashtml smcgroup3
selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice smcashtml3
selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice smcgroup3
smcsymbol selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
smcsymbol selffindpr-pangvhtml3
smproductlistidgetprice smcgroup3
selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice smproductlistidgetprice3
sexp sexpreplacesug3
var24
ca23
1-319
cm18
mwst15
11smproductsetattributesmathumb15
smcgroup15
19zzgl15
smcsymbol15
versandmehr15
true12
toboolwahr11
detailslieferzeitnbsplieferbar11
werktagensmproduct10
false9
mit7
grifflnge7
mora6
sexp6
smproduct6
gesamtlnge6
detailssmproduct6
messer5
05
nbsp5
arbeitsmesser5
produkte4
toboolfalsch4
jquerywindowloadfunction4
warenkorb4
14
werktagenmehr4
110smproductsetattributesmathumb4
werktageninkl4
imagealign3
nearsize3
23
iftoboolfalsch3
sbscrollbutton3
fixed3
alignelemstogrid3
handlelabel3
alignelemsperrow3
gridstyle3
isscrollable3
farsize3
forcegrid3
click3
el3
functiondir3
hostfix3
btn3
eldatascrollbutton3
minibasket3
addclassui-corner-all3
smallicons3
handlecorners3
showbuttonalways3
target3
autoposition3
position3
offset3
inside3
33
selffindpr-save-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
self3
pl-celleachfunction3
product3
jquerythis3
id3
pricing3
parseintselfdatapkid3
each3
function3
ifsmproductnull3
smproductlist3
ifsmproductlistnull3
null3
aus3
schwarzinkl3
43
selffindpr-pre-pricehtmlcprimaryformatsmproductlistidgetoriginalprice3
selffindpr-now-pricehtmlcprimaryformatsmproductlistidgetprice3
texpship-surcharge-info3
iftransvalue3
transporthintdatavalue3
sexpreplacesug3
cprimaryformattransvalue3
pnl-quantitysmartform3
transporthinthtmlsexp3
transvalue3
selffindpr-transp-hint3
jetzt3
selffindpr-sec-pricehtmlcsecondaryformatsmproductlistidgetprice3
smcashtml3
smproductlistidgetprice3
selffindpr-pangvhtml3
transporthint3
formatproductbasepricesmproductlistid3
handlebox3

What are the nameservers for hkgt.de?

Hkgt.de Domain Nameserver Information

HostIP AddressCountry
docks11.rzone.de 81.169.146.21Germany Germany
shades11.rzone.de 85.214.0.241Germany Germany

Hkgt.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hkgt.de is a scam?