Domain summary

Last updated
2021-04-06
Domain label
hmr
Domain extension
gov.in
Domain registered:
2008-07-02
Domain updated:
2021-04-06
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hmr.gov.in ranked relative to other sites:

Percentage of visits to hmr.gov.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hmr.gov.in registered?
A: Hmr.gov.in was registered 12 years, 9 months, 2 weeks, 5 days, 7 hours, 24 minutes, 6 seconds ago on Wednesday, July 2, 2008.
Q: When was the WHOIS for Hmr.gov.in last updated?
A: The WHOIS entry was last updated 2 weeks, 1 day, 7 hours, 24 minutes, 6 seconds ago on Tuesday, April 6, 2021.
Q: What are Hmr.gov.in's nameservers?
A: DNS for Hmr.gov.in is provided by the following nameservers:
  • ns4.ctrls.in
  • ns5.ctrls.in
Q: Who is the registrar for the Hmr.gov.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Hmr.gov.in?
A: Hmr.gov.in has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hmr.gov.in each day?
A: Hmr.gov.in receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hmr.gov.in resolve to?
A: Hmr.gov.in resolves to the IPv4 address 182.18.162.83.
Q: In what country are Hmr.gov.in servers located in?
A: Hmr.gov.in has servers located in the India.
Q: What webserver software does Hmr.gov.in use?
A: Hmr.gov.in is powered by Apache webserver.
Q: Who hosts Hmr.gov.in?
A: Hmr.gov.in is hosted by CtrlS Datacenters Ltd. in India.
Q: How much is Hmr.gov.in worth?
A: Hmr.gov.in has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Hmr.gov.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hmr.gov.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Hmr.gov.in

H1 Headings

1 :
  1. MD's Desk

H2 Headings

5 :
  1. MISSION OF HMR
  2. Hyderabad Metro Rail
  3. HMR Highlights
  4. People Speak Out
  5. HMR Ideal Solution

H3 Headings

4 :
  1. Please Sing Up
  2. Welcome to HMR
  3. Know Your Metro
  4. Project Highlights

H4 Headings

9 :
  1. Get Social
  2. Gallery
  3. Quick Links
  4. About us
  5. Follow us
  6. Visitors Count
  7. Metro Rail
  8. Address
  9. Contact

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

32 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-34391057-1

Links - Internal

38:

Links - Internal (nofollow)

0:

Links - Outbound

10:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hmr.gov.in

40pxrgba0 0 0metro rail5px 7b5e24modernwidth 90 marginrgba0commuteautogreenmorergba0 0auto 0displayimportant mediasayselevatedmediahyderabadlineheightup150px4metrofontsize0pxcitytextdecorationauto 0 automodalcontent0 auto0 5px 7b5e24projectoffhisboxshadow90 margintravellingfalsehasdisplay blockmargin 150pxblock6get0150px auto 0backgroundnonehepositioncenterdocumentreadyfunctionusrailimportantexperiencescreen and maxwidth70 0textdecoration none7b5e240 0 5pxintroabsolute10pximportant media screenhyderabad metrocenter centermodaldialog widthmaxwidthwidthvarmodalbodyheightwindowelevated metro railmodaldialogelevated metromodalcontent modalcontentcolormgbsread moreread150px autowidth 1005pxvideosnorepeatmodaldialog width 902media screen0 5pxtrafficscreenmargin 150px autowidth 90position absolute1contacthyderabad metro railright30pxfffthroughhmr3topmargin5padding

Longtail Keyword Density for Hmr.gov.in

KeywordsOccurences
hyderabad metro rail7
important media screen5
screen and max-width5
auto 0 auto4
rgba0 0 03
elevated metro rail3
0 0 5px3
0 5px 7b5e243
modal-dialog width 903
width 90 margin3
margin 150px auto3
150px auto 03
metro rail12
hyderabad metro11
media screen10
0 auto6
0 06
modal-dialog width6
important media5
auto 04
read more4
modal-content modal-content4
width 1003
margin 150px3
90 margin3
width 903
0 5px3
text-decoration none3
5px 7b5e243
center center3
elevated metro3
position absolute3
rgba0 03
display block3
150px auto3
031
metro24
hyderabad16
width16
rail12
auto12
screen12
center12
important11
media10
hmr10
modal-content9
off9
background8
modal-dialog8
margin8
18
top7
max-width7
height7
none7
27
modal-body6
position6
font-size6
he6
var5
says5
5px5
read5
through5
project5
city5
color5
traffic4
mgbs4
commute4
more4
get4
intro4
modern4
right4
line-height4
40px4
padding4
10px4
display4
fff4
window3
7b5e243
text-decoration3
documentreadyfunction3
33
30px3
43
false3
elevated3
53
63
no-repeat3
block3
rgba03
absolute3
73
box-shadow3
0px3
contact3
us3
up3
green3
videos3
has3
travelling3
experience3
his3
150px3

Who hosts Hmr.gov.in?

Hmr.gov.in Hosting Provider Information

Hosted IP Address:182.18.162.83
Hosted Hostname:static-182-18-162-83.ctrls.in
Service Provider:CtrlS Datacenters Ltd.
Hosted Country:IndiaIN
Location Latitude:20.0063
Location Longitude:77.006
Webserver Software:Apache

Is "CtrlS Datacenters Ltd." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CtrlS Datacenters Ltd.
0.0143%

HTTP Header Analysis for Hmr.gov.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 06 Apr 2021 22:12:56 GMT
Server: Apache
X-XSS-protection: 1; mode=block
x-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=31536000; preload
Referrer-Policy: strict-origin
Last-Modified: Tue, 22 Dec 2020 12:20:55 GMT
Accept-Ranges: bytes
Content-Length: 62392
Cache-Control: private, no-cache, no-store, proxy-revalidate, no-transform
Pragma: no-cache
Content-Type: text/html

Hmr.gov.in Domain Nameserver Information

HostIP AddressCountry
ns4.ctrls.in 182.18.166.50
ns5.ctrls.in 103.231.77.205


Need to find out who hosts Hmr.gov.in?


Domain Registration (WhoIs) information for Hmr.gov.in

 Domain Name: hmr.gov.in
Registry Domain ID: D2811450-IN
Registrar WHOIS Server:
Registrar URL: http://registry.gov.in
Updated Date: 2021-03-24T06:30:12Z
Creation Date: 2008-02-07T06:30:12Z
Registry Expiry Date: 2022-02-07T06:30:12Z
Registrar: National Informatics Centre
Registrar IANA ID: 800111
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok http://www.icann.org/epp#OK
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: HYDERABAD METRO RAIL LIMITED
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: ANDHRA PRADESH
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: IN
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: ns4.ctrls.in
Name Server: ns5.ctrls.in
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-06T22:12:57Z

Websites with Similar Names

Hmr--inc.com
hmr--inc.com - This website is for sale! - hmr--inc Resources and Information.
Hmr-allure.com
Hair and make room allure: ?????????????????????????????!!
Hmr-apparel.com
Site Under Construction
Hmr-communications.com
Account Suspended
Hmr-consultadoria.com
:: HMR Consultadoria ::
Hmr-gmbh.net
Vertriebspartner werden für Absperrtechnik | Zauntechnik | Verkehrssicherheit | H.M.R. GmbH
Hmr-gmbh.org
Bauzaun kaufen & Mieten | Kabelbrücken mieten | Hamburger Gitter | H.M.R. GmbH
Hmr-international.de
HMR deutsch – Beratung, Forschung, Publikationen und Veranstaltungen
Hmr-kagoshima.tokyo
hmr-kagoshima.tokyo

Recently Updated Websites

2scfb.com (1 second ago.)Ffr-shop.de (1 second ago.)Lightboxcanvas.com (2 seconds ago.)Stjosephgranite.com (2 seconds ago.)Mirrorspace.org (2 seconds ago.)Churchphoneapps.com (2 seconds ago.)Insureandgo.com (2 seconds ago.)Idle.cc (3 seconds ago.)Spb-massage.ru (3 seconds ago.)Aaroncarreno.com (3 seconds ago.)Sjovedanskesange.dk (3 seconds ago.)Medcanfarma.com (4 seconds ago.)Simoneagoussoye.blog (5 seconds ago.)Backendhelp.com (5 seconds ago.)Hvh.ca (5 seconds ago.)Orlandoentertainmentnews.com (5 seconds ago.)Urlai.com (5 seconds ago.)Herowheel.com (5 seconds ago.)Downtowndetectives.com (6 seconds ago.)Teamshelleyspiroobrienre.com (6 seconds ago.)Privieseller.com (6 seconds ago.)Offtheeatenpath.show (6 seconds ago.)Dicazine.com.br (7 seconds ago.)Atexnika.com (8 seconds ago.)Wonogiri.xyz (8 seconds ago.)Mahoninglaoh.com (8 seconds ago.)Nimento.network (9 seconds ago.)Aobsug.work (9 seconds ago.)Betheflownow.com (9 seconds ago.)Luciekarbulova.cz (9 seconds ago.)

Recently Searched Keywords

brinquedos cesta (1 second ago.)these enclosures (3 seconds ago.)aggressive stroke for cum sluts cei (3 seconds ago.)lição avulsa (4 seconds ago.)leia tudo >> (5 seconds ago.)cursos bblicos (7 seconds ago.)el hazek projects (9 seconds ago.)video – clip (10 seconds ago.)r1990 por r1590 (11 seconds ago.)30 grad lagerung vor und nachteile (13 seconds ago.)bíblia letras maiores (14 seconds ago.)топливный шланг (16 seconds ago.)roar fitness timetable (17 seconds ago.)acute hae (19 seconds ago.)hướng dẫn chuẩn bị lễ vật và bài văn khấn mâm cúng dời văn phòng (24 seconds ago.)typeof windowformcallback (24 seconds ago.)live sex cam shows (24 seconds ago.)sedition (26 seconds ago.)consultinginternal (26 seconds ago.)turing award (27 seconds ago.)the seiko srpd25 monster (28 seconds ago.)creado con wordpress (28 seconds ago.)trường tiểu học linh phú (30 seconds ago.)productdata jfunction if (31 seconds ago.)acessórios - igreja (32 seconds ago.)usman vs. masvidal 2 (33 seconds ago.)工业级桌面3d打印机 (34 seconds ago.)mua bán nhà đất lăk (34 seconds ago.)elmclassnamesplit ifel1 (34 seconds ago.)carrinho detalhes (35 seconds ago.)