Hockeycanada.ca  |  The Official Website Of Hockey Canada
Low trust score  | 



Hockeycanada.ca Website Information

Website Ranks & Scores for Hockeycanada.ca

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:68,553
Majestic Rank Majestic Rank:51,822
Domain Authority Domain Authority:71%
DMOZ DMOZ Listing:No

Whois information for hockeycanada.ca

Full Whois Lookup for Hockeycanada.ca Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Hockeycanada.ca. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name: hockeycanada.ca
Domain status: registered
Creation date: 2000/11/08
Expiry date: 2021/12/01
Updated date: 2015/01/12
DNSSEC: Unsigned

Registrar:
Name: Internic.ca Inc.
Number: 29

Registrant:
Name: Hockey Canada

Administrative contact:
Name: Craig Cameron
Postal address: 151 Canada Olympic Road S.W. Suite 201
Calgary AB T3B6B7 Canada
Phone: +1.4037773624
Fax: +1.4037773635
Email: Login to show email
contact:
Name: Craig Cameron
Postal address: 151 Canada Olympic Road S.W. Suite 201
Calgary AB T3B6B7 Canada
Phone: +1.4037773624
Fax: +1.4037773635
Email: Login to show email
servers:
dns1.easydns.com
dns2.easydns.net
dns3.easydns.org

% WHOIS look-up made at 2017-08-16 05:44:05 (GMT)
%
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at http://www.cira.ca/legal-notice/?lang=en
%
% (c) 2017 Canadian Internet Registration Authority, (http://www.cira.ca/)

Who hosts Hockeycanada.ca?

Hockeycanada.ca is hosted by Microsoft Corporation in Virginia, Bristow, United States, 20136.
Hockeycanada.ca has an IP Address of 137.135.69.209 and a hostname of 137.135.69.209 and runs Microsoft-IIS/8.5 web server.



Hockeycanada.ca Web Server Information

Hosted IP Address:137.135.69.209
Hosted Hostname:137.135.69.209
Service Provider:Microsoft Corporation
Hosted Country:United StatesUS
Location Latitude:38.7228
Location Longitude:-77.5361
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Hockeycanada.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
X-UA-Compatible: IE=edge
Date: Sat, 04 Jul 2015 01:45:22 GMT
Content-Length: 25656


Need to find out who hosts Hockeycanada.ca?

Hockeycanada.ca Free SEO Report

Website Inpage Analysis for Hockeycanada.ca

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hockeycanada.ca

red 2div div iframepaddingimportantheightauto importantplaydivmouseoutfunction eventcontentimagesplaybuttonlatestsmallpngwindowvideopositionerseriescorporate about hockeyeventsfontsizebackgroundrepeatnorepeat backgroundsize autobackscrollwindowwidthworld0 varimages9nationalpaddingbottom 5pxhadschedule media galleryvideophotocarouselhomevideophotocarouseltitlefirstnone10pxmobile appscareerscolorimportant documentreadyfunctioninstagramtophalfstory201718 nwdt glddiv divreturnthu aug 17mediaska st12float5national women39sfinaleet thu auggoogletagcmdpushfunctionu18 teamhorizmultieventscoreboardsmoothdivscrolljumptoelementmaskheightscoreboardwidthbackgroundsize201718 national women39scampnwu18t blkplaydivmouseoverfunction eventnwdtetabindexrosterreturn falsechallengeolympic201718false functionfinalpxappsgamewindowrecentnewscountbackgroundrepeatnorepeat backgroundsizeu17nwdt gldstatessethockey canadahockey programsmorepaddingbottomdevelopmentwhitewinwidthwinheightplaydivmouseoverfunctionif1backgroundsize auto 48pxiframe width100 importantexhibitioncup schedulecontactmedia gallerycanada hockey48pxdayhelpsettimeoutfunctionsansserifscheduleimportant documentreadyfunction googletagcmdpushfunctionchampionshipscentralizationiiwidth100 important documentreadyfunctionetbackgroundoffsetcommunitynewscanadianlastbody2video201718 nwdtplaydivmouseoutfunctionaditemwidth100 aditemskadiv width100 importantheightautoauto 48pxnews schedulepartnerships careers contactnewwidth100careers contactnwu18tcanthu1 exhibitionevent thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallpngif thisisvisible ifsubtitlevsticketsu18schedule mediawindowheightschedule 201711elsecupprogramsfontfamilythishidewomenshelpingimportantheightauto important aditemcanadasthu augusanoevents newsreturn false functionworld juniorgamesbackgroundpositionright center backgroundrepeatnorepeat10development campeach4div width100varwidth100 importantheightautobackgroundcolorcanada hockey canadaebutbackgroundpositionright centerevent thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallrolloverpngdataotevents news schedulegoalscreen201718 national1230 pmaugthisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallpngwidth100 importantheightauto importantplaydivmouseoverfunction event thisfindplaybuttonattrsrcwinnational men39salumniheightcoastshortthisisvisible ifpmbackgroundsize autogwgeventcompletebeatcenter backgroundrepeatnorepeatcanadacontentimagesplaybuttonlatestsmallrolloverpngwinnerdocumentcreateelementimgmobileunited statesfontweight8buyhockeyquarterstorycanada foundationaditemwidth100 aditem div0gallery201718 national men39sthisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallrolloverpngitemstoshowautocenter backgroundrepeatnorepeat backgroundsizehockey canada foundation201718 nwu18tfollowfullstoryiframe width100aditem div width100tabaditem divcentertruemostrecentmostpopularunder17et thupadding 10pximportant aditem divdocumentcreateelementdivaditemwidth100importantheightautowidthpartnershipsmen39sevent thisfindplaybuttonattrsrcteam canadateamgldsolideventshifttimeif thisisvisiblenews schedule media3aditemjuniorscoreddisplaynone5pxblackcorporatestiframeshopredbackgroundpositionrightimportantplaydivmouseoutfunction event thisfindplaybuttonattrsrcam etaditem div divdisplaybackgroundrepeatnorepeatfunction201718 nwu18t blk2017 worldnbspheight and widthgetkidsdiv iframe width100subseasonidwidth100 importantthisisvisiblewomen39s2017 world juniorinitiationintrasquadblksodocumentreadyfunction googletagcmdpushfunctionelse ifamprogramfloatleftpartnerships careerseventidgoldfoundationwhturlits2017 u1710px solidunitedlanguagecodeleft6important aditemfalseupjunior a challengediv iframefirst shiftdocumentreadyfunctionmaskwidthdocumentcreateelementspan7divthisfindplaybuttonattrsrcaug 17

Longtail Keyword Density for Hockeycanada.ca

KeywordsOccurences
aditem div div8
importantheightauto important aditem8
width100 importantheightauto important8
div div iframe8
div iframe width1008
important documentreadyfunction googletagcmdpushfunction8
width100 important documentreadyfunction8
iframe width100 important8
div width100 importantheightauto8
important aditem div8
aditemwidth100 aditem div7
aditem div width1007
playdivmouseoutfunction event thisfindplaybuttonattrsrc6
playdivmouseoverfunction event thisfindplaybuttonattrsrc6
canada hockey canada4
event thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallrolloverpng4
if thisisvisible if4
height and width4
2017-18 nwu18t blk4
events news schedule4
event thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallpng4
2017-18 national men39s4
schedule media gallery4
news schedule media4
hockey canada foundation3
2017-18 nwdt gld3
background-positionright center background-repeatno-repeat3
background-repeatno-repeat background-size auto3
background-size auto 48px3
partnerships careers contact3
center background-repeatno-repeat background-size3
corporate about hockey3
et thu aug3
thu aug 173
2017 world junior3
junior a challenge3
2017-18 national women39s3
return false function3
hockey canada17
aditem div15
event thisfindplaybuttonattrsrc12
media gallery11
2017-18 national10
div div10
important documentreadyfunction9
div width1008
documentreadyfunction googletagcmdpushfunction8
width100 importantheightauto8
width100 important8
iframe width1008
div iframe8
important aditem8
importantheightauto important8
aditemwidth100 aditem7
u18 team6
playdivmouseoutfunction event6
playdivmouseoverfunction event6
2017-18 nwu18t5
thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallpng5
world junior5
2017 world5
thisfindplaybuttonattrsrc contentimagesplaybuttonlatestsmallrolloverpng5
2017 u175
mobile apps5
ska st4
0 var4
first shift4
if thisisvisible4
return false4
red 24
padding-bottom 5px4
nwu18t blk4
false function4
events news4
thisisvisible if4
news schedule4
schedule 20174
schedule media4
development camp4
careers contact4
canada hockey4
national men39s4
cup schedule4
team canada4
center background-repeatno-repeat3
background-positionright center3
nwdt gld3
background-repeatno-repeat background-size3
am et3
background-size auto3
10px solid3
hockey programs3
auto 48px3
2017-18 nwdt3
partnerships careers3
aug 173
national women39s3
else if3
padding 10px3
thu aug3
1230 pm3
united states3
et thu3
1 exhibition3
canada foundation3
var50
if40
canada36
div29
hockey26
2017-1825
important20
018
schedule18
event17
width10017
116
function16
documentreadyfunction16
team15
aditem15
national14
thisfindplaybuttonattrsrc14
media14
width13
documentcreateelementdiv13
red13
213
gallery12
game12
312
mostrecentmostpopular12
412
10px11
more10
else10
false10
510
first10
aug9
news9
scored9
height9
world8
importantheightauto8
iframe8
googletagcmdpushfunction8
u188
tickets8
cup8
aditemwidth1007
mobile7
video7
new7
background-color7
data7
gold7
exhibition6
blk6
windowwidth6
roster6
gld6
5px6
contentimagesplaybuttonlatestsmallpng6
camp6
return6
playdivmouseoverfunction6
playdivmouseoutfunction6
ska6
junior6
up5
u175
get5
win5
contentimagesplaybuttonlatestsmallrolloverpng5
set5
display5
last5
screen5
black5
auto5
itemstoshow5
solid5
color5
final5
et5
can5
center5
nwu18t5
events5
window5
apps5
challenge5
sans-serif4
corporate4
am4
url4
had4
scoreboardwidth4
padding-bottom4
nwdt4
videopositioner4
64
men39s4
shift4
intrasquad4
program4
ot4
font-family4
under-174
wht4
74
so4
px4
thishide4
games4
contact4
settimeoutfunction4
maskwidth4
careers4
subtitle4
thisisvisible4
st4
instagram4
usa4
development4
font-size4
maskheight4
fullstory4
halfstory4
quarterstory4
each4
backgroundoffset4
horizmultieventscoreboardsmoothdivscrolljumptoelement4
body4
alumni4
none4
font-weight3
eventcomplete3
goal3
windowrecentnewscount3
white3
winheight3
top3
winwidth3
windowheight3
floatleft3
float3
buy3
83
displaynone3
languagecode3
beat3
background-repeatno-repeat3
background-size3
background-positionright3
help3
left3
gwg3
helping3
48px3
canadas3
day3
scroll3
eventid3
subseasonid3
vs3
93
true3
united3
canadian3
womens3
no3
series3
partnerships3
championships3
women39s3
olympic3
centralization3
programs3
community3
foundation3
images3
tab3
shop3
states3
follow3
nbsp3
padding3
103
initiation3
coast3
videophotocarousel-homevideophotocarousel3
e3
title3
ii3
documentcreateelementimg3
etabindex3
113
kids3
finale3
short3
winner3
its3
123
thu3
time3
pm3
back3
but3
documentcreateelementspan3

What are the nameservers for hockeycanada.ca?

Hockeycanada.ca Domain Nameserver Information

HostIP AddressCountry
dns1.easydns.com 64.68.192.10Canada Canada
dns2.easydns.net 198.41.222.254United States United States
dns3.easydns.org 64.68.196.10Canada Canada

Hockeycanada.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hockeycanada.ca is a scam?