Hockeychambly.ca

Checking...
Association du Hockey Mineur de Chambly
Low trust score
Add a review Change category Claim this site
Site web officiel de l'Association du Hockey Mineur de Chambly.


Domain summary

Domain label
hockeychambly
Domain extension
ca
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hockeychambly.ca ranked relative to other sites:

Percentage of visits to hockeychambly.ca from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hockeychambly.ca registered?
A: Hockeychambly.ca was registered 1 week, 6 days, 8 hours, 49 minutes, 53 seconds ago on Friday, September 11, 2020.
Q: When was the WHOIS for Hockeychambly.ca last updated?
A: The WHOIS entry was last updated 1 week, 6 days, 8 hours, 49 minutes, 53 seconds ago on Friday, September 11, 2020.
Q: What are Hockeychambly.ca's nameservers?
A: DNS for Hockeychambly.ca is provided by the following nameservers:
  • my.privatedns.com
  • your.privatedns.com
Q: Who is the registrar for the Hockeychambly.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for Hockeychambly.ca?
A: Hockeychambly.ca has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hockeychambly.ca each day?
A: Hockeychambly.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hockeychambly.ca resolve to?
A: Hockeychambly.ca resolves to the IPv4 address 192.175.107.253.
Q: In what country are Hockeychambly.ca servers located in?
A: Hockeychambly.ca has servers located in the Canada.
Q: What webserver software does Hockeychambly.ca use?
A: Hockeychambly.ca is powered by Apache webserver.
Q: Who hosts Hockeychambly.ca?
A: Hockeychambly.ca is hosted by iWeb Technologies Inc. in Quebec, Montreal, Canada, H3e.
Q: How much is Hockeychambly.ca worth?
A: Hockeychambly.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hockeychambly.ca?

Hockeychambly.ca Hosting Provider Information

Hosted IP Address:192.175.107.253
Hosted Hostname:192.175.107.253
Service Provider:iWeb Technologies Inc.
Hosted Country:CanadaCA
Location Latitude:45.4579
Location Longitude:-73.5493
Webserver Software:Apache

Is "iWeb Technologies Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Hockeychambly.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 11 Sep 2020 06:37:20 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
Access-Control-Allow-Origin: https://apps.publicationsports.com
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Hockeychambly.ca Domain Nameserver Information

HostIP AddressCountry
my.privatedns.com 174.142.253.5
your.privatedns.com 67.205.116.5


Need to find out who hosts Hockeychambly.ca?


WhoIs information for Hockeychambly.ca

 Domain Name: hockeychambly.ca
Registry Domain ID: D1314530-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: www.hexonet.net
Updated Date: 2020-08-25T14:23:00Z
Creation Date: 2010-06-11T20:42:22Z
Registry Expiry Date: 2021-06-11T04:00:00Z
Registrar: HEXONET Services Inc.
Registrar IANA ID:
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: 82338071-CIRA
Registrant Name: Hockey mineur Chambly
Registrant Organization:
Registrant Street: 994 boul. Brassard, C.P. 242
Registrant City: Chambly
Registrant State/Province: QC
Registrant Postal Code: J3L6H5
Registrant Country: CA
Registrant Phone: +1.5145318582
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: 84063877-CIRA
Admin Name: Francois Gagnon
Admin Organization: Hockey mineur Chambly
Admin Street: 994 boul. Brassard, C.P. 242
Admin City: Chambly
Admin State/Province: QC
Admin Postal Code: J3L6H5
Admin Country: CA
Admin Phone: +1.5145318582
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: 84063878-CIRA
Tech Name: Francois Gagnon
Tech Organization: Hockey mineur Chambly
Tech Street: 994 boul. Brassard, C.P. 242
Tech City: Chambly
Tech State/Province: QC
Tech Postal Code: J3L6H5
Tech Country: CA
Tech Phone: +1.5145318582
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Billing ID:
Billing Name:
Billing Organization:
Billing Street:
Billing City:
Billing State/Province:
Billing Postal Code:
Billing Country:
Billing Phone:
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email:
Name Server: my.privatedns.com
Name Server: your.privatedns.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-09-11T06:37:20Z

Hockeychambly.ca Free SEO Report

Website Inpage Analysis for Hockeychambly.ca

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

5 :
  1. Les dernières nouvelles
  2. Photos & Vidéos
  3. Partenaires
  4. Social
  5. Dernières nouvelles

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

26 :

Google Adsense

:
pub-4689641866351665

Google Analytics

:
UA-6174930-1

Links - Internal

34:
  1. No text
    https://www.hockeychambly.ca/fr/index.html
  2. Accueil
    https://www.hockeychambly.ca/fr/index.html
  3. Nouvelles
    https://www.hockeychambly.ca/fr/publication/nouvelle.html
  4. Pratique local
    https://www.hockeychambly.ca/fr/fichiers/3200.html
  5. Inscriptions camp d'évaluation
    https://www.hockeychambly.ca/fr/page/information_camp_devaluation_2020.html
  6. Documents
    https://www.hockeychambly.ca/fr/fichiers/5589.html
  7. COVID-19
    https://www.hockeychambly.ca/fr/page/informations_covid-19.html
  8. Documentation
    https://www.hockeychambly.ca/fr/fichiers.html
  9. Boutique
    https://www.hockeychambly.ca/fr/page/boutique.html
  10. Nous joindre
    https://www.hockeychambly.ca/fr/contact.html
  11. HORAIRES & CLASSEMENTS
    https://www.hockeychambly.ca/fr/stats/index.html
  12. No text
    https://www.hockeychambly.ca/fr/publication/nouvelle/camp_de_selection_junior_aa-1.html
  13. Camp de sélection Junior AA
    https://www.hockeychambly.ca/fr/publication/nouvelle/camp_de_selection_junior_aa-1.html
  14. Lire l'article
    https://www.hockeychambly.ca/fr/publication/nouvelle/camp_de_selection_junior_aa-1.html
  15. No text
    https://www.hockeychambly.ca/fr/publication/nouvelle/cliniques_de_gardien.html
  16. Cliniques de gardien
    https://www.hockeychambly.ca/fr/publication/nouvelle/cliniques_de_gardien.html
  17. Lire l'article
    https://www.hockeychambly.ca/fr/publication/nouvelle/cliniques_de_gardien.html
  18. No text
    https://www.hockeychambly.ca/fr/publication/nouvelle/inscriptions_terminees-1.html
  19. Inscriptions terminées
    https://www.hockeychambly.ca/fr/publication/nouvelle/inscriptions_terminees-1.html
  20. Lire l'article
    https://www.hockeychambly.ca/fr/publication/nouvelle/inscriptions_terminees-1.html
  21. No text
    https://www.hockeychambly.ca/fr/publication/nouvelle/retroaction.html
  22. Rétroaction
    https://www.hockeychambly.ca/fr/publication/nouvelle/retroaction.html
  23. Lire l'article
    https://www.hockeychambly.ca/fr/publication/nouvelle/retroaction.html
  24. No text
    https://www.hockeychambly.ca/fr/publication/nouvelle/informations_pour_les_joueurs_accompagnateurs_et_entraineurs.html
  25. INFORMATIONS POUR LES JOUEURS, ACCOMPAGNATEURS ET ENTRAÎNEURS
    https://www.hockeychambly.ca/fr/publication/nouvelle/informations_pour_les_joueurs_accompagnateurs_et_entraineurs.html
  26. Lire l'article
    https://www.hockeychambly.ca/fr/publication/nouvelle/informations_pour_les_joueurs_accompagnateurs_et_entraineurs.html
  27. Voir toutes les nouvelles
    https://www.hockeychambly.ca/fr/publication.html
  28. No text
    https://www.hockeychambly.ca/fr/albums/vedettes_du_mois.html
  29. No text
    https://www.hockeychambly.ca/fr/videos/rapides_atome_b_saison_2016-2017.html
  30. No text
    https://www.hockeychambly.ca/fr/videos/rapides_atome_b_2016-2017_fun.html
  31. No text
    https://www.hockeychambly.ca/fr/albums/photo_dequipe_2016-2017.html
  32. Photo
    https://www.hockeychambly.ca/fr/albums.html
  33. Vidéo
    https://www.hockeychambly.ca/fr/videos.html
  34. Nous contacter
    https://www.hockeychambly.ca/fr/contact.html

Links - Internal (nofollow)

0:

Links - Outbound

30:
  1. Se connecter
    https://www.publicationsports.com/connexion.html?comingFrom=fr&location=https%3A%2F%2Fwww.hockeychambly.ca%2Ffr%2Findex.html
  2. Guide - Inscription en ligne
    https://www.publicationsports.com/ressources/files/923/GUIDE-Inscription_en_ligne-Hockey_Chambly_(Carte_de_Credit)_2020.pdf
  3. Inscriptions joueurs
    https://www.publicationsports.com/ressources/files/923/Document_Inscription_2020-2021_-_Covid-19_(version_6).pdf
  4. Inscriptions personnel de banc et bénévoles
    https://www.publicationsports.com/ressources/files/923/Document_Inscription_2020-2021_-_Entraineurs-Benevoles.pdf
  5. Inscription Hockey Adapté
    https://www.publicationsports.com/ressources/files/923/Inscription_au_programme_Hockey_Adapte.pdf
  6. Horaire de matchs ligue vallée du richelieu
    http://liguesectionvallee.hockey-richelieu.qc.ca/fr/stats/index.html
  7. Ligue Élite du Richelieu
    http://ligueelite.hockey-richelieu.qc.ca/fr/stats/index.html
  8. Tournoi
    http://www.tournoipeeweechambly.ca/fr/index.html
  9. Calendrier HMC (local)
    https://www.retroaction.ca/Schedule/Index/OWNmYzZlMmEtYzI3NS00NDQ5LWExNDktZmMxM2VkMmE1YWE1
  10. Calendrier Forts (élite)
    https://www.retroaction.ca/Schedule/Index/YmFlMWQxYjEtNzZkNC00ODJiLWEwNTktZjFlNjQ3YTU2MTY2
  11. Comment indiquer sa présence avec Rétroaction
    https://youtu.be/k3f9pKnJbIY
  12. Hockey Richelieu
    http://www.hockey-richelieu.qc.ca/
  13. Hockey Québec
    http://www.hockey.qc.ca/
  14. Hockey Canada
    http://www.hockeycanada.ca/
  15. HockeyShare - Exercices
    http://www.hockeyshare.com/drills/
  16. Exercices pour hockey en patins à roues alignées
    http://www.whockey.com/work/cirsa/drillbook/
  17. Coach.ca - Le coaching en général
    http://www.coach.ca/
  18. Jes-Hockey - Exercices animés (anglais)
    http://www.jes-hockey.com/animated/drills.html
  19. Hockey Canada
    https://www.hockeycanada.ca/en-ca/Hockey-Programs/Drill-Hub
  20. Hockey Québec - Documents pour les entraîneurs
    http://www.hockey.qc.ca/fr/fichiers.html
  21. Ligue Canadienne de Hockey
    http://fr.chl.ca/main/index
  22. Ligue de Hockey Junior Majeur du Québec
    http://www.lhjmq.qc.ca/
  23. Ligue Nationale de Hockey
    http://www.lnh.com/
  24. Canadiens de Montréal
    http://www.canadiens.com/
  25. No text
    https://www.hockey.qc.ca/fr/page/retour_au_hockey.html
  26. No text
    https://www.facebook.com/metrocollin/
  27. No text
    http://www.facebook.com/sportsxchambly/
  28. HockeyMineurDeChambly
    https://www.facebook.com/https://www.facebook.com//HockeyMineurDeChambly/
  29. No text
    http://www.spordle.com/
  30. Politique de confidentialité
    https://www.spordle.com/fr/confidentialite/

Links - Outbound (nofollow)

0:

Keyword Cloud for Hockeychambly.ca

chamblymediaretour auhockeyretour au jeuwebkittransformimgslireotransformfontsizeresponsivesocialfeeds lirtroaction0px2pour10px responsivesocialfeedsmaxwidth1s10px responsivesocialfeeds instagramheaderpositionaueaseinoutwidthet0px 5px 0pxle1s easeinout10pxavecnouvellesresponsivesocialfeeds instagramheadermoztransforminstagramheaderlarticlejeu0px 0px 5px5px 0pxau jeupour lesjuniorlire larticleretourcetteresponsivesocialfeeds fbpagepaddingvartranslate0transformmedia screendu5px 0px rgba00002responsivesocialfeeds01leftnbspinscriptionsdestruecliniques de gardientranslate0 50fbpagebackgroundopacity 1s easeinoutrgba00002cliniquesscreen and maxwidth0px 5pxjunior aaopacity 1snousaa201620175px15px 0importantles15pxopacitygardiendanscampscreenagraveif0px rgba00002skew12degfunction0px 0pxli

Longtail Keyword Density for Hockeychambly.ca

KeywordsOccurences
opacity 1s ease-in-out5
screen and max-width3
retour au jeu3
cliniques de gardien3
10px responsivesocialfeeds instagramheader3
0px 0px 5px3
0px 5px 0px3
5px 0px rgba000023
responsivesocialfeeds li6
translate0 -505
lire larticle5
1s ease-in-out5
opacity 1s5
10px responsivesocialfeeds4
junior aa4
au jeu3
retour au3
responsivesocialfeeds fb-page3
15px 03
responsivesocialfeeds instagramheader3
0px 0px3
0px 5px3
5px 0px3
0px rgba000023
media screen3
pour les3
responsivesocialfeeds23
013
var12
les10
du9
0px9
nouvelles8
le8
10px7
pour7
opacity7
li6
5px6
larticle5
15
translate05
lire5
hockey5
agrave5
junior5
et5
1s5
ease-in-out5
retour5
padding4
left4
skew12deg4
max-width4
au4
aa4
skew-12deg4
15px4
camp4
inscriptions4
position4
-o-transform3
transform3
function3
background3
font-size3
fb-page3
instagramheader3
img3
rgba000023
s3
-moz-transform3
cliniques3
-webkit-transform3
important3
if3
23
des3
rtroaction3
avec3
media3
screen3
nous3
width3
jeu3
nbsp3
gardien3
cette3
dans3
chambly3
2016-20173
true3

Hockeychambly.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hockeychambly.ca is a scam?

Websites with Similar Names

Hockedeals.com
Hocke Deals - Hocke Deals
Hockeenight.com
Hockee Night
Hockenburyelectric.com
Licensed Electrician Somerset County NJ Commercial and Residential.
Hockenheim.de
Startseite - Stadt Hockenheim
Hockenheimring.de
Hockenheimring - Motorsport auf dem traditionsreichen Hockenheimring in Baden-Württemberg
Hockenhullturkeysltd.com
Hockenhull Turkeys: Premium Quality Turkey Poults

Recently Updated Websites

Maxgladwell.com 3 seconds ago.Uberboda.com 4 seconds ago.Assetbenefitconsultants.com 5 seconds ago.Corneliaconnellylibrary.org 5 seconds ago.Auroramarine.com 6 seconds ago.Acaiberry-supple.net 6 seconds ago.Stayonthelake.com 6 seconds ago.Kosoft.com 6 seconds ago.Virtualfunder.com 8 seconds ago.Christiansapp.net 8 seconds ago.Prathamglobal.com 8 seconds ago.Queens-quest.com 8 seconds ago.Snapresponder.com 10 seconds ago.Marketblade.com 10 seconds ago.Ponies.ky 10 seconds ago.Mqad.com 10 seconds ago.Reform-yamagata.com 10 seconds ago.Draftingdiva.com 11 seconds ago.K2mga.com 12 seconds ago.Nycleaves.org 12 seconds ago.Vudico.com 13 seconds ago.Theaiexperience.com 13 seconds ago.Pearlsofpersia.com 14 seconds ago.Louisianamarijuanadelivery.com 16 seconds ago.Sao47.com 16 seconds ago.Wuyunhua77.com 18 seconds ago.Hoobae.com 18 seconds ago.Campaign-kenshou.com 21 seconds ago.Parkourparc.com 22 seconds ago.E-vulgarisationci.net 22 seconds ago.