Hoeffner.de  |  Möbel Höffner Möbelhaus - Hochwertige Möbel zu günstigen Preisen
Low trust score  | 
Möbel Höffner - Wo Wohnen wenig kostet! Ausführliche Fachberatung & exzellenter Service im Höffner Möbelhaus! Bei uns finden Sie alles rund ums Wohnen.

Hoeffner.de Website Information

Website Ranks & Scores for Hoeffner.de

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:37,739
Majestic Rank Majestic Rank:254,951
Domain Authority Domain Authority:53%
DMOZ DMOZ Listing:No

Whois information for hoeffner.de

Full Whois Lookup for Hoeffner.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Hoeffner.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html

Domain: hoeffner.de
Nserver: ns1.netnames.net
Nserver: ns2.netnames.net
Status: connect
Changed: 2014-10-10T12:14:51+02:00

Name: NetNames Hostmaster
Organisation: NetNames Ltd
Address: 3rd Floor, Prospero House
Address: 241 Borough High Street
PostalCode: SE1 1GA
City: London
CountryCode: GB
Phone: +44.2070159370
Fax: +44.2070159375
Email: Login to show email

Name: NetNames Hostmaster
Organisation: NetNames Ltd
Address: 3rd Floor, Prospero House
Address: 241 Borough High Street
PostalCode: SE1 1GA
City: London
CountryCode: GB
Phone: +44.2070159370
Fax: +44.2070159375
Email: Login to show email

Who hosts Hoeffner.de?

Hoeffner.de is hosted by MCS Moorbek Computer Systeme GmbH in Hamburg, Hamburg, Germany, 22419.
Hoeffner.de has an IP Address of and a hostname of

Hoeffner.de Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:MCS Moorbek Computer Systeme GmbH
Hosted Country:GermanyDE
Location Latitude:53.5753
Location Longitude:10.0153
Webserver Software:Not Applicable

HTTP Header Analysis for Hoeffner.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 25 Jun 2015 18:18:10 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: Express
X-Request-Id: 43af3740769e4e629162921fe1d7efae
ETag: W/"3c259-2751846440"
Content-Encoding: gzip

Need to find out who hosts Hoeffner.de?

Hoeffner.de Free SEO Report

Website Inpage Analysis for Hoeffner.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hoeffner.de

modernizrihnenbeimit denfr denrotate180degwiehffner finden sieunserenlinkmaskerobaufeinenenergylinksrequirebei hffnerdasvonsearchenablerzubehrsearchsuggestesfeaturecheckwirtransformrequnsererfooterfootnoteshelperwishlistmanagergenericlinkmaskereventmanagerihrsowiesiehabenbietenaucherhalten siejedenihreknnenhffnerdurchmbelbootstrapwir vonsie sichjqueryfancyboxausentdecken siefr jedenzuihresflyouthelperjqueryfooternewsletterhandlerallediesindamptriminputlistenerzumoderfindenpassendenfreinentdeckendemjqueryuipunchberfr diedererhaltenvon hffnersie beimehrhffner findenmittrustedshopshelperihremdenmbel frjqueryuiwerdencampaignhelperklassischesichfinden sietransform rotate180degmbelhausfr ihrebanditeventmanagermbel hffnerunsbei unsmoveupbutton

Longtail Keyword Density for Hoeffner.de

hffner finden sie4
finden sie7
fr ihre5
fr die5
bei hffner5
sie sich5
fr den5
hffner finden4
entdecken sie4
erhalten sie3
von hffner3
mit den3
bei uns3
fr jeden3
transform rotate-180deg3
wir von3
mbel hffner3
sie bei3
mbel fr3

What are the nameservers for hoeffner.de?

Hoeffner.de Domain Nameserver Information

HostIP AddressCountry
ns1.netnames.net States United States
ns2.netnames.net States United States

Hoeffner.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hoeffner.de is a scam?