Favicon Website Thumbnail
Hospitality Talk | Online Magazine
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 7 years, 2 months, 3 weeks, 1 day, 5 hours, 36 minutes, 17 seconds ago on Wednesday, August 7, 2013.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 3 weeks, 4 days, 5 hours, 36 minutes, 17 seconds ago on Sunday, October 4, 2020.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the United States.
Q: What webserver software does use?
A: is powered by webserver.
Q: Who hosts
A: is hosted by Liquid Web, Inc. in Michigan, Lansing, United States, 48917.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:Liquid Web, Inc.
Hosted Country:United StatesUS
Location Latitude:42.7348
Location Longitude:-84.6245
Webserver Software:Not Applicable

Is "Liquid Web, Inc." in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 04 Oct 2020 14:33:56 GMT
Server: Apache/2.4.46 (cPanel) OpenSSL/1.1.1h mod_bwlimited/1.4 mod_fcgid/2.3.9
X-Powered-By: PHP/5.6.40
Link:; rel="", ; rel=shortlink
Cache-Control: max-age=600
Expires: Sun, 04 Oct 2020 14:43:56 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 21412
Content-Type: text/html; charset=UTF-8 Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for

 Domain Name:
Registry Domain ID: D7464698-IN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2020-07-09T04:21:02Z
Creation Date: 2013-07-08T07:11:46Z
Registry Expiry Date: 2021-07-08T07:11:46Z
Registrar: Endurance Domains Technology LLP
Registrar IANA ID: 801217
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: Durga Das Publications Private Limited
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Delhi
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server:
Name Server:
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2020-10-04T20:03:17Z Free SEO Report

Website Inpage Analysis for

H1 Headings

1 :
  1. Hospitality Talk

H2 Headings

0 :

H3 Headings

27 :
  1. Hotel Sahara Star on COVID-19
  2. Accor Showcase 2020- a positive and promising outlook for the travel and tourism industry
  3. Discover South East Coast of Mauritius at Anantara Iko Mauritius Resort and Villas
  4. Swedish innovation revolutionises the global hotel industry
  5. The Fern Residency opens in…
  6. Hyatt’s first Thompson Hotels property in Colorado to open…
  7. FHRAI opposes OYO’s unethical practices
  8. MOT seeks industry suggestions to create guidelines on weddings
  9. Mandarin Oriental Hotel Group and Oberoi Group announce strategic alliance
  10. Pullman New Delhi Aerocity announces home delivery
  11. Accor and Bureau Veritas launch a label based on sanitary measures
  12. Double Tree by Hilton Gurgaon feeds underprivileged impacted by lockdown
  13. Hilton launches Curated Home Deliveries
  14. All is not lost?
  15. Hemant Mediratta launches new river cruise brand with luxury service offerings
  16. Jaison Chacko takes over as Secretary General, FHRAI
  17. Tanveer Kwatra is taking over the reins at W Goa
  18. Manav Malhotra, General Manager, Le Méridien Mahabaleshwar Resort & Spa
  19. Jayakrishnan Sudhakaran, General Manager, Novotel Ahmedabad
  20. Marriott International launches Global Cleanliness Council
  21. AYANA Rewards loyalty program for exclusive benefits and rewards points
  22. Shower to relax
  23. FHRAI opposes OYO’s unethical practices
  24. Mandarin Oriental Hotel Group and Oberoi Group announce strategic alliance
  25. Signing of Wyndham Jaipur Ramgarh Resort
  26. The Leela Group make a debut in Jaipur
  27. Accor’s new campaign tapping domestic travellers to start from Oct 1

H4 Headings

8 :
  1. Cover Story
  2. Breaking News
  3. Most Popular
  4. In-The-Issue
  5. Movements
  6. Products
  7. Talking People
  8. Editor Picks

H5 Headings

0 :

H6 Headings

0 :


0 :

Total Images

32 :

Google Adsense


Google Analytics


Links - Internal

  1. Home
  8. TECH
  11. F & B
  12. TRENDS
  13. SPA
  14. About Us
  15. Subscribe
  16. Contact Us
  17. Hospitality Talk
  18. No text
  19. Hotel Sahara Star on COVID-19
  20. Accor Showcase 2020- a positive and promising outlook for the travel and tourism industry
  21. Discover South East Coast of Mauritius at Anantara Iko Mauritius Resort and Villas
  22. No text
  23. Swedish innovation revolutionises the global hotel industry
  24. No text
  25. FHRAI opposes OYO’s unethical practices
  26. No text
  27. MOT seeks industry suggestions to create guidelines on weddings
  28. No text
  29. Mandarin Oriental Hotel Group and Oberoi Group announce strategic alliance
  30. No text
  31. Pullman New Delhi Aerocity announces home delivery
  32. No text
  33. Accor and Bureau Veritas launch a label based on sanitary measures
  34. No text
  35. Double Tree by Hilton Gurgaon feeds underprivileged impacted by lockdown
  36. No text
  37. Hilton launches Curated Home Deliveries
  38. No text
  39. All is not lost?
  40. Movements
  41. No text
  42. Hemant Mediratta launches new river cruise brand with luxury service offerings
  43. No text
  44. Jaison Chacko takes over as Secretary General, FHRAI
  45. No text
  46. Tanveer Kwatra is taking over the reins at W Goa
  47. No text
  48. Manav Malhotra, General Manager, Le Méridien Mahabaleshwar Resort & Spa
  49. No text
  50. Jayakrishnan Sudhakaran, General Manager, Novotel Ahmedabad
  51. Products
  52. No text
  53. Marriott International launches Global Cleanliness Council
  54. No text
  55. AYANA Rewards loyalty program for exclusive benefits and rewards points
  56. No text
  57. Shower to relax
  58. No text
  59. No text
  60. Archive »
  61. Signing of Wyndham Jaipur Ramgarh Resort
  62. The Leela Group make a debut in Jaipur
  63. No text
  64. No text
  65. No text
  66. Accor’s new campaign tapping domestic travellers to start from Oct 1
  67. Privacy Policy

Links - Internal (nofollow)


Links - Outbound

  1. No text
  2. No text
  3. No text
  4. No text
  5. The Fern Residency opens in…
  6. Hyatt’s first Thompson Hotels property in Colorado to open…

Links - Outbound (nofollow)


Keyword Cloud for

announceddelhiblockquotemandarin orientalhotel group0strategic allianceahover tduid25f79dd5877d37randoberoibfhrai opposes oyostdblock3000000 tduid25f79dd5877d37randannounceoverblocktitlemandarinahoverarrsplitsioriental hotel038yourtalk1oberoi group announceopposeshotelshastduid25f79dd5877d37rand blocktitleunethical practicesinterviewshtmldivinnerhtmlvaryour passwordgroup announceopposes oyosindustry2allianceresortunethicalpasswordgeneralfallriverannounce strategic allianceaccorppracticesluxurymandarin oriental hoteloriental hotel grouphospitalitystrategicnew tdblockampopposes oyos unethicaloyosblockquote pgroup and oberoispagroupfhraihoteltrendsjaipurorientaloyos unethical practices000000new delhileelasigninggroup announce strategicdestinationannounce strategichomearrlengthiftduid25f79dd5877d37randlaunchesfhrai opposesnewhtmldivcssoberoi groupoyos unethicalus

Longtail Keyword Density for

mandarin oriental hotel4
oriental hotel group4
group and oberoi4
fhrai opposes oyos3
opposes oyos unethical3
oyos unethical practices3
oberoi group announce3
group announce strategic3
announce strategic alliance3
blockquote p8
new tdblock6
mandarin oriental4
ahover tduid25f79dd5877d37rand4
strategic alliance4
oberoi group4
hotel group4
oriental hotel4
announce strategic3
group announce3
new delhi3
your password3
oyos unethical3
opposes oyos3
fhrai opposes3
tduid25f79dd5877d37rand block-title3
000000 tduid25f79dd5877d37rand3
unethical practices3
arrsplitsi3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names
Félicitations ! Votre domaine a bien été créé chez OVH !
Hospi-Tales | Acquired Brain Injury (ABI): from the acute hospital to early rehabilitation – more on: and
Hospi-Trans Medical Translations - Traducciones Médicas

Recently Updated Websites 3 seconds 4 seconds 5 seconds 6 seconds 6 seconds 6 seconds 6 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 9 seconds 9 seconds 10 seconds 11 seconds 11 seconds 11 seconds 12 seconds 12 seconds 12 seconds 12 seconds 13 seconds 13 seconds 13 seconds 13 seconds 13 seconds 13 seconds 14 seconds 14 seconds ago.