Công ty cổ phần Công nghệ số Thiên Quang (HostingViet)

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 137,298
Estimated Worth: $96,600

HostingViet.vn cung cấp Dịch vụ hosting Việt Nam, Máy chủ ảo VPS, cho thuê chỗ đặt máy chủ, Đăng ký tên miền, Thiết kế web giá rẻ.Hỗ trợ 24/7/365. LH:02466567555



Domain summary

Last updated
2021-04-17
Domain label
hostingviet
Domain extension
vn
Global Traffic Rank
137,298
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$96,600
Estimated daily income
$161
Estimated monthly income
$4,897

Frequently Asked Questions (FAQ)

Q: When was Hostingviet.vn registered?
A: Hostingviet.vn was registered 7 months, 1 week, 6 days, 9 hours, 31 minutes, 19 seconds ago on Saturday, April 17, 2021.
Q: When was the WHOIS for Hostingviet.vn last updated?
A: The WHOIS entry was last updated 7 months, 1 week, 6 days, 9 hours, 31 minutes, 19 seconds ago on Saturday, April 17, 2021.
Q: Who is the registrar for the Hostingviet.vn domain?
A: The domain has been registered at .
Q: What is the traffic rank for Hostingviet.vn?
A: Hostingviet.vn ranks 137,298 globally on Alexa. Hostingviet.vn has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Hostingviet.vn each day?
A: Hostingviet.vn receives approximately 12,908 visitors and 64,540 page impressions per day.
Q: What IP address does Hostingviet.vn resolve to?
A: Hostingviet.vn resolves to the IPv4 address 103.81.86.64.
Q: In what country are Hostingviet.vn servers located in?
A: Hostingviet.vn has servers located in the Vietnam.
Q: What webserver software does Hostingviet.vn use?
A: Hostingviet.vn is powered by LiteSpeed webserver.
Q: Who hosts Hostingviet.vn?
A: Hostingviet.vn is hosted by KNET Techonlogy (BeiJing) Co.,Ltd. in Vietnam.
Q: How much is Hostingviet.vn worth?
A: Hostingviet.vn has an estimated worth of $96,600. An average daily income of approximately $161, which is roughly $4,897 per month.

Hostingviet.vn Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hostingviet.vn Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Hostingviet.vn

H1 Headings

1 :
  1. Dịch vụ hosting | Thuê máy chủ ảo VPS | Đăng ký tên miền giá rẻ

H2 Headings

11 :
  1. Hosting giá rẻ
  2. SEO Hosting
  3. Reseller Host
  4. VPS Starter - VPS giá rẻ
  5. VPS Chuyên nghiệp
  6. VPS Cao cấp
  7. Reseller Cloud VPS
  8. Thuê Server riêng
  9. Thuê chỗ đặt máy chủ server FPT, VIETTEL, VDC
  10. Dịch vụ nổi bật
  11. Dịch vụ của chúng tôi

H3 Headings

13 :
  1. Cloud VPS Basic 1
  2. SEO Hosting 5 IPs
  3. SEO Hosting #C 3IP
  4. Host Không Giới Hạn
  5. Host giá rẻ 1GB
  6. Web Hosting Giá rẻ
  7. Cho thuê Máy chủ & Chỗ đặt
  8. Tại sao chọn chúng tôi?
  9. Khách hàng đánh giá
  10. Về Hosting Việt
  11. Trợ giúp
  12. Tin tức HostingViet
  13. Đăng ký nhận tin

H4 Headings

17 :
  1. Host sinh viên giá rẻ và các gói host phục vụ cá nhân
  2. SEO Hosting khác Class C (Khác lớp C)
  3. Đăng ký tài khoản đại lý bán host. Bạn có thể tự tạo tài khoản cho khách hàng.
  4. VPS dành cho người mới bắt đầu
  5. VPS Chuyên nghiệp
  6. Cloud VPS cấu hình cao thay thế máy chủ riêng
  7. Tự tạo Virtual Private Cloud (VPC) / Public Cloud / Cloud VPS của riêng Bạn!
  8. Thuê máy chủ riêng, máy chủ vật lý
  9. Bảng giá thuê chỗ đặt máy chủ
  10. Tư vấn dịch vụ
  11. Tin công nghệ
  12. Tư vấn tên miền
  13. Bản tin HostingViet
  14. Thiết Kế Website
  15. Dịch vụ Hosting chất lượng cao
  16. Dịch vụ tên miền
  17. Ứng dụng và quảng cáo

H5 Headings

5 :
  1. Thiết kế web chuẩn SEO, Responsive, công nghệ design, lập trình mới nhất...
  2. HostingViet Cung cấp dịch vụ Hosting giá rẻ sử dụng ổ cứng SSD. Cung cấp Hosting linux và hosting windows
  3. HostingViet cung cấp tên miền Việt Nam, tên miền Quốc tế giá tốt nhất...
  4. Chúng tôi viết các ứng dụng, Phần mềm quản lý doanh nghiệp, Quảng cáo online &Thương hiệu
  5. Chính sách và qui định chung

H6 Headings

14 :
  1. Tư vấn dịch vụ
  2. Tin công nghệ
  3. Tư vấn lựa chọn tên miền phù hợp
  4. Các thông báo, thông tin khuyến mại dịch vụ
  5. Hỗ trợ chỉ có tại HostingViet - DV Hosting
  6. Check list công việc quản trị Server miễn phí
  7. Tư vấn lựa chọn tên miền phù hợp
  8. HostingViet Đơn vị đi đầu cung cấp Unlimited Hosting
  9. Hướng dẫn sử dụng Hosting
  10. Dịch vụ Thiết kế website
  11. Tư vấn Sử dụng dịch vụ Hosting
  12. Dịch vụ SEO Hosting
  13. Dịch vụ Hosting giá rẻ
  14. Dịch vụ VPS giá rẻ

Total IFRAMEs

1 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-35734579-1

Links - Internal

84:

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hostingviet.vn

height jquerythisinnerheight jquerycartlistt mua ngaykhonthnghosttcmin ph chngheight jquerythisinnerheightmmthit k webheight 0enter a valuejquerycartlist contentheightheighttn minphthibcreturndntabsif jquerythisinnerheight heightmy chthitmin quc tlinuxdatatypeni2navbarnavti y tquc tnavbarnav livar height 0chng ch sslcentertopjqueryajaxphnhiuch t mychuyn nghipvnhostingviet cung cpy tnewcselectvn la chncalinschucho thuthit kch sslc xemkhch hngmin1tinheight 0 jquerycartlistenter a validamprtthuthu ch tathisreturnjquerydocumentreadyfunctiondch vcot muaqueryyrmainmenuquy nhemailtntype post datatypes dngv hosting git vnchntyif jquerythisinnerheightthu chch sslckhngwindowlocationhrefinstanceofvicxemchuyncolor1successmijquerythisinnerheight jquerycartlist contentheightheighthnquycpvpsmua ngayt my chjquerythisinnerheightipdomaincng tyurlngaymuabreturnhosting gi rmycontentheightheightvcontentheightheight 60ccfalsereturnchi titheight heightch tvarthandateautonghresellerkhchtrulk weblin htcunglmjquerycartlistnhtcc bnchng chthu mybnwchng tingjqueryajax urlfalseareturnchi tit tigii hngiqucti khonhng dnsslc xem chit myheight height jquerythisinnerheightserverresult0ng ksplitcontenteachfunction ifcodereturnfunction resultpost datatypehosting gisslclngcng nghgi rcaocontenteachfunctiongiifunctionlinghipcontenteachfunction if jquerythisinnerheightsslc xemjquerythisvalchithu my chjquerycartlist contentheightheight 60hngdch v hostingdngvitseo hostingv hostinghmtinbsppagebnghostingviettn min quckeywordcung cpchng3textmin quccloudhosting dchnamey t muaph chnglxem chi titsuccess function resultdatati y800pxreturn falsetit ti ychonhvar heighthosting dch vhostingmainmenu ulvaluejquerycartlist contenteachfunctionsearchobjectringtype posttimepickerpickerhideiwidgetfindtimepickerddiftypejquerycartlist contenteachfunction ifjquerythisinnerheight height heightph chng chbng gichsuccess functionjquerythisinnerheight jquerycartlistkmin phdndchnhnvihostingviet cungtin tcvalidhnhchnh schcloud vpsseo0 jquerycartlistjquerythisinnerheight heightlm vicpostchnhtitcngunlimitedswebtit tixem chiheight

Longtail Keyword Density for Hostingviet.vn

KeywordsOccurences
dch v hosting6
enter a valid6
y t mua5
t mua ngay5
hosting gi r5
var height 04
height 0 jquerycart-list4
enter a value4
contenteachfunction if jquerythisinnerheight4
if jquerythisinnerheight height4
jquerythisinnerheight height height4
height height jquerythisinnerheight4
height jquerythisinnerheight jquerycart-list4
sslc xem chi4
ch sslc xem4
chng ch sslc4
ph chng ch4
min ph chng4
ti y t4
tit ti y4
chi tit ti4
xem chi tit4
jquerythisinnerheight jquerycart-list contentheightheight3
jquerycart-list contentheightheight 603
type post datatype3
jquerycart-list contenteachfunction if3
thit k web3
v hosting gi3
ch t my3
min quc t3
tn min quc3
vn la chn3
hostingviet cung cp3
thu ch t3
thu my ch3
t my ch3
hosting dch v3
success function result3
dch v23
tn min13
gi r11
t vn8
v hosting8
min ph8
my ch8
cung cp6
ng k6
seo hosting6
mua ngay5
chng ch5
y t5
ti y5
xem chi5
s dng5
cng ngh5
t mua5
chng ti5
cloud vps5
thit k5
hosting gi5
ti khon5
cc bn4
chnh sch4
quy nh4
main-menu ul4
hng dn4
contenteachfunction if4
contentheightheight 604
jquerythisinnerheight jquerycart-list4
height jquerythisinnerheight4
var height4
height 04
height height4
jquerythisinnerheight height4
if jquerythisinnerheight4
0 jquerycart-list4
lin h4
navbar-nav li4
sslc xem4
hosting dch4
chi tit4
tit ti4
ph chng4
ch t4
ch sslc4
type post3
post datatype3
success function3
function result3
khch hng3
jqueryajax url3
chuyn nghip3
jquerycart-list contentheightheight3
return false3
thu ch3
hostingviet cung3
t my3
bng gi3
thu my3
jquerycart-list contenteachfunction3
tin tc3
cng ty3
lm vic3
gii hn3
quc t3
min quc3
cho thu3
k web3
var43
v34
t26
dch24
hosting24
if24
ti23
ch22
min19
function19
gi17
016
enter14
h14
tn13
ng13
vps13
c13
height12
cng12
k12
jquerycart-list12
tin11
r11
cc10
chng10
vn10
xem10
nh9
ph9
hng9
s9
cloud9
bn9
new8
my8
hostingviet8
dng8
thu8
unlimited8
jquerythisinnerheight8
email7
host7
seo7
return7
bng7
17
cp7
li7
y6
valid6
instanceof6
cung6
ngay6
tr6
m6
cho6
ngh5
chi5
lm5
page5
nhn5
hn5
khon5
mua5
server5
gii5
dd5
thit5
url5
value5
lng5
sch4
navbar-nav4
athisreturn4
vic4
chnh4
24
quy4
34
dn4
ul4
contenteachfunction4
bcreturn4
contentheightheight4
date4
main-menu4
khng4
rt4
amp4
lin4
mi4
nghip4
cao4
hnh4
chn4
thng4
ni4
web4
vit4
tit4
sslc4
l3
ty3
jquerythisval3
jqueryajax3
type3
post3
datatype3
data3
success3
result3
khch3
reseller3
auto3
chuyn3
false3
dntabs3
windowlocationhref3
nbsp3
keyword3
800px3
quc3
color13
query3
u3
linux3
vi3
top3
ip3
falsereturn3
co3
name3
than3
select3
domain3
tc3
mm3
breturn3
w3
areturn3
timepicker-pickerhideiwidgetfindtimepicker3
jquerydocumentreadyfunction3
phn3
searchobject3
split3
hiu3
text3
thi3
ca3
ring3
nht3
code3

Who hosts Hostingviet.vn?

Hostingviet.vn Hosting Provider Information

Hosted IP Address:103.81.86.64
Hosted Hostname:103.81.86.64
Service Provider:KNET Techonlogy (BeiJing) Co.,Ltd.
Hosted Country:VietnamVN
Location Latitude:16.0023
Location Longitude:105.9999
Webserver Software:LiteSpeed

Is "KNET Techonlogy (BeiJing) Co.,Ltd." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%
KNET Techonlogy (BeiJing) Co.,Ltd.
0.1058%

HTTP Header Analysis for Hostingviet.vn

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
x-powered-by: PHP/7.2.21
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
content-type: text/html; charset=UTF-8
content-encoding: gzip
vary: Accept-Encoding
content-length: 270668
date: Sat, 17 Apr 2021 11:58:02 GMT
server: LiteSpeed
connection: Keep-Alive

Hostingviet.vn Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Hostingviet.vn?


Domain Registration (WhoIs) information for Hostingviet.vn

Websites with Similar Names

Hosti-skript.biz
click.com.cn
Hosti.eu
Darmowe sklepy internetowe, załóż własny darmowy sklep internetowy
Hosti.us
Client Portal | Hosti
Hostia.in
Hostia Industries
Hostia.name
403 Forbidden
Hostia.net
NameBright - Coming Soon
Hostia.ru
Хостинг сайтов ХостиЯ - самый дешевый качественный платный интернет ru хостинг для сайта
Hostiamo.com
HugeDomains.com

Recently Updated Websites

Freshtopia.net (10 seconds ago.)Hotel-isis.com (13 seconds ago.)Parelprogram.com (15 seconds ago.)Restoringhands.com (16 seconds ago.)Madabouttinseltown.net (16 seconds ago.)Dadsorganicmarket.com (19 seconds ago.)Heartbeatlovequotes.com (22 seconds ago.)Woodriverchevrolet.com (25 seconds ago.)Ruthsole.com (25 seconds ago.)Franzbrinkerconsulting.com (26 seconds ago.)Siroa.net (27 seconds ago.)Chelanglamping.com (30 seconds ago.)Trees2cut.com (31 seconds ago.)Selvaggiohairdressing.com (33 seconds ago.)Yaqibet1770.app (35 seconds ago.)Cupsdirect.co.uk (35 seconds ago.)Anythingdisplay.com (36 seconds ago.)Mayostreetarts.org (40 seconds ago.)Refinanceroadmap.com (43 seconds ago.)Careaboutclimate.org (46 seconds ago.)Hisselial.com (49 seconds ago.)Heyuanmeizhi.net (52 seconds ago.)Textyounow.com (52 seconds ago.)186969.com (53 seconds ago.)Connecticutceu.com (55 seconds ago.)Scienceandsafetyconsulting.net (56 seconds ago.)Michiganlavendergrowers.com (57 seconds ago.)Shopmoonxcosmetic.com (57 seconds ago.)Hamblenvotes.com (57 seconds ago.)Discountcableties.com.au (58 seconds ago.)

Recently Searched Keywords

servisi split klima (1 second ago.)0padding6pxborder0cursorpointer (3 seconds ago.)8217 zmk (3 seconds ago.)venturini service srl (3 seconds ago.)alertmee (5 seconds ago.)bayti dso (8 seconds ago.)search-suggestions menu (10 seconds ago.)nangduyencos (11 seconds ago.)the dude (14 seconds ago.)tema yapmak (15 seconds ago.)roasted vegetable (15 seconds ago.)technician (16 seconds ago.)justice and creative reuse (16 seconds ago.)nin (16 seconds ago.)swim swim (18 seconds ago.)зеленый (20 seconds ago.)(continue reading) (21 seconds ago.)our exclusive editors (22 seconds ago.)bears hardcore review (23 seconds ago.)有声电台 (24 seconds ago.)05191 (25 seconds ago.)e wystpi (25 seconds ago.)partners & suppliers (25 seconds ago.)yg 공식입장 (26 seconds ago.)z28 (26 seconds ago.)好朋友的妈妈 (26 seconds ago.)pradesh india (26 seconds ago.)generic-modalbtn-close (26 seconds ago.)vikiway (27 seconds ago.)iherb-header-accountiherb-header-account-signed-in (28 seconds ago.)