Homepage | house.gov

Safety: High trust score
Year Founded: 2021
Global Traffic Rank: 703
Estimated Worth: $22,982,400



Domain summary

Last updated
2021-06-21
Domain label
house
Domain extension
gov
Global Traffic Rank
703
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$22,982,400
Estimated daily income
$21,280
Estimated monthly income
$647,267

Frequently Asked Questions (FAQ)

Q: When was House.gov registered?
A: House.gov was registered 10 months, 4 weeks, 6 hours, 18 minutes, 44 seconds ago on Monday, June 21, 2021.
Q: When was the WHOIS for House.gov last updated?
A: The WHOIS entry was last updated 10 months, 4 weeks, 6 hours, 18 minutes, 44 seconds ago on Monday, June 21, 2021.
Q: What are House.gov's nameservers?
A: DNS for House.gov is provided by the following nameservers:
  • pdns109.ultradns.biz
  • pdns109.ultradns.net
  • pdns109.ultradns.com
  • pdns109.ultradns.org
  • oxygen2.house.gov
  • oxygen.house.gov
Q: Who is the registrar for the House.gov domain?
A: The domain has been registered at .
Q: What is the traffic rank for House.gov?
A: House.gov ranks 703 globally on Alexa. House.gov has a High trust score, and a Statvoo Rank of A.
Q: How many people visit House.gov each day?
A: House.gov receives approximately 2,660,028 visitors and 21,280,224 page impressions per day.
Q: What IP address does House.gov resolve to?
A: House.gov resolves to the IPv4 address 34.194.109.118.
Q: In what country are House.gov servers located in?
A: House.gov has servers located in the United States.
Q: What webserver software does House.gov use?
A: House.gov is powered by webserver.
Q: Who hosts House.gov?
A: House.gov is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.
Q: How much is House.gov worth?
A: House.gov has an estimated worth of $22,982,400. An average daily income of approximately $21,280, which is roughly $647,267 per month.

House.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

House.gov Free SEO Report

Website Related Search Terms

Website Inpage Analysis for House.gov

H1 Headings

2 :
  1. Legislative Activity
  2. House Overview

H2 Headings

36 :
  1. Most Recent Votes
  2. Search Congress.gov
  3. Representatives
  4. View Representatives by State
  5. Leadership
  6. Speaker of the House: Rep. Nancy Pelosi
  7. Democratic Leadership
  8. Republican Leadership
  9. Committees
  10. Officers and Organizations
  11. Chaplain of the House
  12. Chief Administrative Officer
  13. Clerk of the House
  14. Sergeant at Arms
  15. General Counsel
  16. Historian of the House
  17. Inspector General
  18. Office of Congressional Ethics
  19. Parliamentarian of the House
  20. Legislative Counsel
  21. Congressional Partners
  22. Architect of the Capitol
  23. Capitol Police
  24. Congressional Budget Office
  25. Government Accountability Office
  26. Government Printing Office
  27. Library of Congress
  28. National Archives
  29. United States Senate
  30. Public Disclosure
  31. Financial Disclosure Reports
  32. Foreign Travel Reports
  33. Gifts and Travel Filings
  34. Legal Expense Fund Disclosures
  35. Statement of Disbursements
  36. Life at the House

H3 Headings

8 :
  1. Majority Leader
  2. Majority Whip
  3. Assistant Speaker
  4. Democratic Caucus Chairman
  5. Republican Leader
  6. Republican Whip
  7. Republican Conference Chairman
  8. Republican Policy Committee Chairman

H4 Headings

8 :
  1. Rep. Steny Hoyer
  2. Rep. James Clyburn
  3. Rep. Katherine Clark
  4. Rep. Hakeem Jeffries
  5. Rep. Kevin McCarthy
  6. Rep. Steve Scalise
  7. Rep. Liz Cheney
  8. Rep. Gary Palmer

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

382:

Links - Internal (nofollow)

0:

Links - Outbound

29:

Links - Outbound (nofollow)

0:

Keyword Cloud for House.gov

reauthorizationstudentsstates capitolsecurity 1000 aminfrastructureact hrsystemservicescommitteethroughappropriationssubcommittee on defense300 pm fiscalnatural resourcessubcommitteeexamining the policiesforeign1000 am usservicesfull committeeinternational developmentfyexpandinggeorgiamodernization2021 timeiraqarmyrequestcommitteeus departmentpuerto ricofloor proceedingsenvironmentalmiddle1100 am fy22innovativechildpm creatingaffairssubcommittee on europeemploymentresources 200 pmdrinking watervisitorsvirginiasopportunity actchildrenfriday junecapabilitiessessionaffairssubcommittee on economicrequestcommittee on armedcapital accessact of 2021committeehomeland securityjohnfuturecreditsteveeurope energymresourcessubcommitteesupplytechnologies and informationmilitary constructionmaritimehousesupporteducation labormeanssecuritypm virtualdanfiscalbudgetcommitteehomelessnessoverviewprogramscommitteeinterfere with freerepealservicessubcommittee on oversightchairman repserviceafricaeconomic growthunited states codeusespeakeret session 300international economic policyprioritiesjudiciarysubcommitteetechnologysubcommittee10economic developmenthearingcommitteecarecommitteeservices educationselectstates codeam departmentimagesvarforcesohioseacommitteeprotection and commercedefensebriandonaldbudgetreadinesswaterunited states capitolus12water oceansreform 1000migration and internationalcivil rightshouse administrationsubcommittee400 pmrequest for militarydelayscommunitiesauthorizationyear 2022committeerepresentativeballotcommitteejimpm fiscaltime etfairconstitutionpm legislative hearingreviewappropriationssubcommitteeprofilesclimate crisiscommitteearmedeconomic policycommunityiowascotttheiramendmentvirtual hearing15january 6th attackour19fridayimpacteducation and workforcepm hruse of militarymarkopportunity act reauthorizationservices 1200 pmsystemscivil libertiescommercesubcommitteesmallrichardotherhealthham examiningforces 1100national parkspeteupleadertexas930 amactivityaffairs 1000 amindigenous peoplesagriculturalrelatedillinoissearchr 1187responsenational securityarmsresources related1000 am fyeducationalus engagementjoe09005tuesday mayopportunitiessouth carolinaoceans and wildlifefloorrules18recentpolicy 1000 amcommittee 1200public buildingsmichaelnorthrequest1000 amframeworkamscience foundationcoastsession 300veterans039 affairs 1000corporateoversight and reformsubcommitteeworkforcecommerce 1100improvingrecent votespassagetechnology 1100daycommittee on appropriationssubcommitteeaddressinglessonscaribbeancommitteehybrid hearingtechnologysubcommittee on researcheuropetitle 5 unitedmarkupprotectionaircommerce 1100 amam membercongressionalwestern hemisphere civilianservicesfull committee 1200act reauthorizationpotentialengagementspace and technologyinstitutionsfriday may71000 am hrtacticalwatchcommercesubcommittee on healthandyforceborder securitymikehybridduringsecretaryfinancial servicesfullneedhuman servicesallcommerceflorida2021 time ethomeland security 1000mexicoeducational resources relatedwomennevadacivilnebraskaransomwareaffairssubcommitteefy 2022innovationforeign affairssafeinformationalabamacrime3presidentsappropriationssubcommittee on financialwest virginialaborsubcommittee on higherpolicedata and educationallibertiestitle 5sergeant at armsnewrural5 unitednationalfuture actsecuritysubcommitteebuildingsfy22space and technologysubcommitteeaviationelectedappropriationspeoplesqualitywisconsinconventionun convention1187 failedhouse floornatural resourcesrequestcommittee on appropriationssubcommitteerisknational sciencenoprogrammondaylandgregoryinvestmentpostalbusinesssubcommitteeappropriationssubcommittee homeland securityfreeaccountabilitylveterans039 affairsspacecommitteetransportationcivilianlaw17energycommitteeh r 1187medialaborsubcommitteenew mexicohomeland securitysubcommittee1200 pmthursdaycovid19 pandemiccommitteecurrentbased ordercommercesubcommittee on consumerbudget hybridcommitteeconstitution civil rightskansasways and meanssubcommitteebuildinglabortechnologysession 930amendment noexaminationcovid19parksagainst iraq resolutionresearch and technologyletterpresident2yorkpolicies and prioritiesforwardcommitteetime et sessionaccessrules based orderpartair forceservicessubcommittee on cyberimpactsamericanways and meansasiahearingrickselect committeesecurity migrationinvestor0616 hfamiliesrightsexaminingbudget requestcommitteeendingsession 300 pmdataleadership committeesfiscal yearfollowingdavidwroad1200 pm virtualfranklabor 1200 pmwildlifeiraq resolution2021committeemilitaryroleshigher educationservicessubcommittee on seapowernaturaladministrationsoregondeconomic development publicu0026middotlouisianaeconomic opportunityappropriationssubcommittee homelandprogramscommittee on armedtomagreeingoperationssession u0026middotartifactsfree and faircompetitionstate foreign operationsgrowth taxhomelandartifacts images historicalprojection forces 1100growthcyber innovative technologiesservicessubcommittee on strategic230 pminvestigationsveterans039pm examiningdaycommitteeactintelligencenational independenceconstitution civiljanuary 6thpm2021 hrrulecommissionhuman services educationsenateearlyfy 2022 budgetdrinkingstatessession 900 ammoststaffscience spacebudget requestdepartment of defenseeducational resourcessafetycreating22 2021codeentrepreneurshipjerseyforces 1100 amworkersappropriationssubcommittee on state2021replgbtqiauthorization for usewednesdayhearing on hrcvirtualindependencehigherinvestingstrategicrepresentativesmanagementgovernmentprofiles artifacts imagesrelated agenciesunited statescitizenshipmakinggeneral governmentmike californiaenvironmentclimateperspectivesnational independence daysocialcaresession 1100 ammembers of congressinformation systemsconstructionethistoricalhistorical essaysam member daycommittee1100 am maritimesubcommitteechaplainstrategyjameslabor healthforce against iraqr 1187 failedbackcommitteescommittee 1000 amstatericoamericacommitteemissourih rpoliciessimplification actsession 900rules basedadministrationsubcommitteechange300 pm creatingmemberpreparednessvoting in americaforestsdevelopment public buildingsconsumer protectionattackservices and generallegalmaritime securityreform 1000 amservicecommitteeresveterans039 affairssubcommitteeorderdemocraticseapower and projectiondepartment of energycommitteechris newtimseapowerresourceactcommitteeindopacificrobertreformeducation laborsubcommitteeagainstveterans affairsbillspennsylvaniaamerica the potentialrepeal the authorizationlabor 1200et session 930pm legislativeutaham us200 pmtax0900 ampipelineaffairssubcommittee on westernannofficerselectionsyearworkforce innovationmichiganpolicy 1000debbieron9capitolwestam buildingtennesseerepreadinesscommitteeproceedingsunaccompanieddepartmentoversightenergy and mineralrelated programsimages historicalsecurity 1000workforce investmentservicessubcommitteeglobalbuildlegislativequestionsam hybridam maritimeadvancingjuneet session 1100strategic forceseconomic growth tax11civilian securityofficeappropriationssubcommittee on laborveteransvotesrepublicanfair accessh reset session 10000616 h rdevelopment publicdonessays dataservicesam virtualoperations and relatedsimplificationtreasuryyear 202214house of representativestechnology 1100 amcreating a frameworkoversight and reformagencypacificam virtual hearingpm departmentpm virtual hearinghearingcommittee on appropriationssubcommitteefinancial institutions0616modernization of congresssmall businesssubcommitteesession 1000 amtransportation and infrastructuresubcommitteereportsfiscal year 2022committeejointsmall businessprojectionimmigrationmarylandcleanoklahoma1015 amtechnologiesservices 1200lastwaysenvironment and climatefy22 budgetinnovative technologiese1000 am oversightchairmanpassedet session 900consumerampagencies2022 budget hybridcommitteewednesday juneresearchforeign operationsspacepm oversightcapitol policeam the bidentax and capitalbidenjanuaryeconomicdevelopmentresourcessubcommittee on energymilitary force againsthemispherehemisphere civiliandisclosure simplification actprotectingmaymeanssubcommitteeclerkterrorismcyber innovativeeducation and relatednational science foundationcaliforniaresources 200botanicindianaservicesfulllandsinternational economiclegislative hearingcapitalpeterexamining the rolecrisisinfrastructuresubcommitteesession 1000images historical essayskevinessaysmississippidayminnesotatravelpm fiscal yearapriljudiciaryfailed900 amemergency managementdisclosure simplificationcoloradocybersecurity2022 budget request1am votingkentuckyagainst iraqindigenousresolutionupdateactcommittee on rulestuesdayfinancial servicessubcommitteevotingequityjoint committeenew jerseyarmed services8retirementoversight hearingcommitteewildlife wednesdayam fyorder in spacecommitteecentraldisclosureeducationviewcivilian security migrationstepsemergencybiden administrationsservicessubcommittee on readinessclimate changeenergycommittee on science16ballotcommittee on househouse administrationscienceam maritime securityconnecticutcarolinaprogramscommittee on smallpolicyet sessiondanielnational parks forestsenvironment and cyberarmed servicessubcommitteeparks forestsjmarkup hrhistorical essays dataadamopportunityrepresentatives leadershipmilitary force6grantmigrationpandemiccommittee1100 am departmentresourcessubcommittee on nationalpuertomineralact of 2021terrorism and homelandforce againstgtuesday junehemisphere civilian securityjudiciarysubcommittee on immigrationmeasurescommitteesecondaryam fy 2022community developmentchrisadministrativecyber6thorganizationswashingtonfederaltitlerepresentatives leadership committeesframework for rulesmonday maysergeantdrugreadiness 300role300 pmbillinclusionyourfinancial servicesfull committee1000 am virtual1100 amhybridcommitteefiscal year 2022rstate foreignwesterncommittee 1000financialthursday mayfoundationam fy22am covid19buildings and emergencymember daycommitteeforeign affairs 1000committee 1200 pmvaenergy and commercesubcommitteehuman6th attackeducation labor 120040arizonatroyjobsprofiles artifactswestern hemisphere2022 budgetinterferepublic landsresourcesforests and publichousingsouth13membersenergy the environmentcoronavirus1000 am memberreformsubcommittee2022committeeinfrastructuresubcommittee on economicagricultureoceansbusinesssubcommittee on economicsbasmineral resourcesunjusticelegislative activityaffairs 1000commercesubcommittee on environmentresourcessubcommittee on indigenoustimeracial5 united statessession 1100pm jointthursday junebasedunitedprogramsmorearkansasyear 2022 budgethroversight and investigationswednesday mayfinancial servicesnancyadministrationjudiciarysubcommittee on crimeinnovation and opportunitydiversityam hrforeign affairssubcommitteeam oversightcaribbeancommittee on foreignamericaindependence dayrights and civilcrime terrorismcounterterrorismpublicfoodfy22 budget requestcommitteeartifacts imagesgeneralnextmost recentblackprojection forcesthomasrecoverybusinessnorth carolina100 pmpursuantinternationalenergyaffairsjrimprovementchallengessession 930 amborderadministrationsubcommittee on electionsresourcessubcommittee on waterimmigration and citizenshipnew yorktedhealth and humancongress1030 amleadershipmassachusettsreadiness 300 pm

Longtail Keyword Density for House.gov

KeywordsOccurences
2021 time et40
time et session40
fiscal year 202220
session 1000 am15
et session 100015
year 2022 budget14
pm virtual hearing13
energy and commercesubcommittee12
space and technologysubcommittee11
oversight and reform11
2022 budget request10
1200 pm virtual10
act of 202110
transportation and infrastructuresubcommittee8
oversight and investigations8
ways and meanssubcommittee7
session 1100 am7
et session 11007
affairs 1000 am7
servicessubcommittee on readiness7
h r 11876
am member daycommittee6
06-16 h r6
services and general6
ways and means6
seapower and projection6
financial servicesfull committee6
pm fiscal year6
united states code6
modernization of congress6
environment and cyber5
energy the environment5
affairssubcommittee on europe5
fy22 budget requestcommittee5
pm legislative hearing5
oversight and reformsubcommittee5
am virtual hearing5
appropriationssubcommittee on financial5
health and human5
1000 am virtual5
rights and civil5
resources 200 pm4
requestcommittee on appropriationssubcommittee4
resourcessubcommittee on water4
servicessubcommittee on strategic4
voting in america4
commercesubcommittee on consumer4
administrationsubcommittee on elections4
programscommittee on armed4
foreign affairs 10004
reform 1000 am4
hearing on hr4
examining the policies4
policies and priorities4
requestcommittee on armed4
national science foundation4
operations and related4
state foreign operations4
appropriationssubcommittee on state4
security 1000 am4
homeland security 10004
1000 am hr4
constitution civil rights4
session 900 am4
programscommittee on small4
et session 9004
house of representatives4
et session 9304
session 930 am4
oceans and wildlife4
protection and commerce4
technologysubcommittee on research4
300 pm fiscal4
forces 1100 am4
servicessubcommittee on seapower4
et session 3004
session 300 pm4
servicessubcommittee on cyber4
cyber innovative technologies4
research and technology4
department of defense4
technologies and information4
1000 am oversight4
services 1200 pm4
images historical essays3
1000 am fy3
education and related3
human services education3
repeal the authorization3
appropriationssubcommittee on labor3
daycommittee on appropriationssubcommittee3
am fy 20223
committee 1000 am3
1000 am us3
commerce 1100 am3
authorization for use3
national parks forests3
forests and public3
1000 am member3
use of military3
national independence day3
military force against3
disclosure simplification act3
title 5 united3
appropriationssubcommittee homeland security3
request for military3
force against iraq3
appropriationssubcommittee on defense3
fy 2022 budget3
artifacts images historical3
1100 am fy223
profiles artifacts images3
2022 budget hybridcommittee3
data and educational3
hearingcommittee on appropriationssubcommittee3
educational resources related3
1100 am department3
r 1187 failed3
5 united states3
space and technology3
historical essays data3
resourcessubcommittee on national3
against iraq resolution3
representatives leadership committees3
energy and mineral3
am maritime security3
framework for rules3
creating a framework3
300 pm creating3
veterans039 affairs 10003
act of 2021committee3
energycommittee on science3
department of energycommittee3
fiscal year 2022committee3
tax and capital3
economic growth tax3
businesssubcommittee on economic3
projection forces 11003
1100 am maritime3
order in spacecommittee3
buildings and emergency3
development public buildings3
economic development public3
infrastructuresubcommittee on economic3
immigration and citizenship3
judiciarysubcommittee on immigration3
servicessubcommittee on oversight3
examining the role3
labor 1200 pm3
education labor 12003
technology 1100 am3
committee 1200 pm3
servicesfull committee 12003
rules based order3
america the potential3
resourcessubcommittee on energy3
migration and international3
environment and climate3
commercesubcommittee on environment3
education and workforce3
laborsubcommittee on higher3
opportunity act reauthorization3
innovation and opportunity3
terrorism and homeland3
judiciarysubcommittee on crime3
resourcessubcommittee on indigenous3
am the biden3
policy 1000 am3
international economic policy3
civilian security migration3
interfere with free3
hemisphere civilian security3
western hemisphere civilian3
affairssubcommittee on western3
caribbeancommittee on foreign3
commercesubcommittee on health3
sergeant at arms3
affairssubcommittee on economic3
actcommittee on rules3
united states capitol3
january 6th attack3
readiness 300 pm3
ballotcommittee on house3
free and fair3
members of congress3
1000 am70
1100 am56
2021 time40
time et40
et session40
200 pm35
1200 pm33
new york27
300 pm27
fiscal year25
100 pm25
armed servicessubcommittee24
year 202220
foreign affairssubcommittee18
virtual hearing18
2022 budget17
united states16
natural resourcessubcommittee15
session 100015
science space14
north carolina14
pm virtual13
financial servicessubcommittee12
homeland security12
budget request12
new jersey12
1030 am11
house administration10
education laborsubcommittee10
homeland securitysubcommittee10
small businesssubcommittee10
small business9
related agencies9
budget requestcommittee9
consumer protection8
legislative hearing8
foreign affairs8
h r8
financial services8
natural resources8
south carolina7
civil rights7
projection forces7
06-16 h7
us department7
am hr7
2021 hr7
am examining7
am member7
affairs 10007
session 11007
armed services7
1015 am7
financial servicesfull6
230 pm6
veterans039 affairssubcommittee6
education labor6
states code6
r 11876
climate change6
pm hr6
member daycommittee6
human services6
general government6
fy22 budget6
pm fiscal6
servicesfull committee6
strategic forces5
europe energy5
joint committee5
international development5
930 am5
900 am5
am department5
am virtual5
capitol police5
am oversight5
biden administrations5
civil liberties5
pm legislative5
related programs5
veterans039 affairs5
act hr4
national science4
services 12004
reform 10004
economic opportunity4
national security4
security 10004
am hybrid4
constitution civil4
forces 11004
session 9304
resources 2004
wednesday may4
h res4
state foreign4
maritime security4
wednesday june4
science foundation4
tuesday june4
foreign operations4
veterans affairs4
session 3004
water oceans4
monday may4
community development4
fy 20224
opportunity act4
tuesday may4
national parks4
thursday may4
400 pm4
select committee4
house administrationsubcommittee4
information systems4
innovative technologies4
pm oversight4
january 6th4
cyber innovative4
session 9004
us engagement3
parks forests3
oversight hearingcommittee3
am voting3
climate crisis3
drinking water3
military construction3
am fy223
chris new3
public lands3
puerto rico3
new mexico3
mike california3
educational resources3
west virginia3
amendment no3
resources related3
essays data3
1187 failed3
chairman rep3
historical essays3
images historical3
artifacts images3
0900 am3
title 53
independence day3
friday june3
national independence3
iraq resolution3
against iraq3
force against3
military force3
simplification act3
disclosure simplification3
profiles artifacts3
pm joint3
thursday june3
budget hybridcommittee3
am building3
air force3
pm department3
5 united3
representatives leadership3
hybrid hearing3
public buildings3
fair access3
based order3
rules based3
pm creating3
markup hr3
year 2022committee3
capital access3
growth tax3
economic growth3
un convention3
am maritime3
emergency management3
development public3
friday may3
economic development3
labor 12003
technology 11003
wildlife wednesday3
border security3
committee 12003
22 20213
house floor3
most recent3
recent votes3
floor proceedings3
legislative activity3
readiness 3003
6th attack3
appropriationssubcommittee homeland3
workforce innovation3
am us3
services education3
labor health3
am fy3
committee 10003
commerce 11003
financial institutions3
mineral resources3
future act3
workforce investment3
higher education3
act reauthorization3
crime terrorism3
states capitol3
indigenous peoples3
policy 10003
economic policy3
international economic3
security migration3
civilian security3
hemisphere civilian3
western hemisphere3
pm examining3
leadership committees3
am covid-193
covid-19 pandemiccommittee3
session u0026middot3
am165
pm139
hr123
070
156
255
california55
house50
new47
session45
oversight45
act45
time42
et40
financial40
committee38
texas37
foreign37
budget36
servicessubcommittee36
hearing36
335
energy34
433
armed31
security29
department29
florida27
527
627
education27
york27
year26
science26
fiscal25
725
small24
natural24
affairssubcommittee24
appropriationssubcommittee23
homeland23
national22
examining21
services21
carolina21
development20
us20
economic20
public19
health19
may19
united19
north19
related19
june18
virtual18
illinois18
pennsylvania18
climate18
congress18
affairs17
space17
resources17
ohio16
states16
protection16
georgia15
resourcessubcommittee15
virginia15
rights15
administration15
representatives15
forces15
policy14
reform14
civil14
michigan14
congressional13
investigations13
h13
workforce13
business13
technology13
legislative13
transportation13
environment13
labor13
america13
international13
ways13
judiciarysubcommittee13
request13
infrastructure12
washington12
information12
rules12
actcommittee12
cyber12
innovation12
covid-1912
defense12
military12
priorities12
jersey12
commercesubcommittee12
programs12
capitol11
consumer11
global11
future11
veterans03911
technologysubcommittee11
811
access11
john11
david10
code10
rep10
businesssubcommittee10
r10
response10
management10
laborsubcommittee10
fy2210
addressing10
securitysubcommittee10
operations10
mike10
water10
research10
federal10
veterans9
arizona9
indiana9
modernization9
requestcommittee9
opportunity9
massachusetts9
agencies9
tennessee9
government9
accountability9
title9
search9
member9
programscommittee9
tuesday9
readiness9
wednesday9
human9
state9
thursday9
joint9
employment9
infrastructuresubcommittee8
general8
wisconsin8
leadership8
friday8
e8
emergency8
06-168
against8
your8
south8
missouri8
commerce8
building8
michael8
office8
amendment8
minnesota8
maryland8
projection8
members7
equity7
tom7
tax7
means7
day7
colorado7
select7
our7
jim7
97
alabama7
daycommittee7
force7
voting7
bill7
meanssubcommittee7
bills7
policies7
crisis7
europe7
markup6
servicesfull6
biden6
part6
106
cybersecurity6
strategic6
kentucky6
potential6
steve6
louisiana6
l6
creating6
res6
reports6
recent6
administrations6
jr6
floor6
change6
improving6
law6
opportunities6
presidents6
intelligence6
monday6
other6
protecting6
var6
through6
social6
committees6
rural6
senate6
role6
seapower6
border6
116
s6
speaker6
air6
attack5
6th5
january5
maritime5
justice5
oregon5
americacommittee5
liberties5
hearingcommittee5
125
passed5
disclosure5
american5
investing5
clerk5
environmental5
impacts5
review5
proceedings5
elections5
update5
135
hybrid5
oklahoma5
next5
educational5
historical5
april5
police5
fair5
workers5
agreeing5
advancing5
scott5
their5
republican5
housing5
reformsubcommittee5
wildlife5
independence5
need5
mark5
judiciary5
c5
arkansas5
systems5
no5
drug5
james5
institutions5
andy5
diversity5
students5
connecticut5
growth5
engagement5
nevada4
brian4
iowa4
president4
army4
pipeline4
road4
clean4
investment4
144
watch4
activity4
land4
agriculture4
commission4
failed4
program4
coronavirus4
representative4
current4
fy4
secondary4
officers4
robert4
debbie4
use4
resolution4
154
joe4
administrationsubcommittee4
d4
improvement4
africa4
chairman4
children4
perspectives4
service4
forwardcommittee4
technologies4
innovative4
data4
competition4
oceans4
foundation4
administrative4
care4
capital4
recovery4
legal4
back4
racial4
build4
grant4
immigration4
reauthorization4
challenges4
chris4
indo-pacific4
ann4
asia4
central4
ending4
inclusion4
mississippi4
all4
constitution4
kansas4
corporate4
migration4
organizations4
impact4
western4
pandemiccommittee4
j4
parks4
utah4
aviation4
entrepreneurship4
164
indigenous4
community4
more4
peoples4
kevin4
budgetcommittee4
va4
m3
thomas3
passage3
09003
donald3
chaplain3
w3
botanic3
dan3
west3
pursuant3
gregory3
nancy3
nebraska3
frank3
pete3
don3
ron3
images3
troy3
g3
mexico3
peter3
artifacts3
ted3
leader3
elected3
essays3
travel3
tim3
daniel3
profiles3
adam3
rick3
order3
rule3
framework3
energycommittee3
system3
last3
2021committee3
letter3
2021rep3
retirement3
expanding3
carecommittee3
ransomware3
based3
strategy3
spacecommittee3
black3
staff3
interfere3
free3
ballotcommittee3
early3
during3
delays3
making3
support3
2022committee3
173
servicecommittee3
unaccompanied3
up3
visitors3
media3
questions3
sergeant3
arms3
votes3
most3
183
servicescommittee3
193
safety3
preparedness3
jobs3
families3
citizenship3
buildings3
counterterrorism3
un3
convention3
seacommittee3
pacific3
supply3
food3
caribbeancommittee3
rico3
secretary3
safe3
examination3
credit3
amp3
child3
treasury3
agency3
forests3
lands3
tactical3
coast3
readinesscommittee3
democratic3
hybridcommittee3
lessons3
lgbtqi3
simplification3
repeal3
authorization3
iraq3
women3
agricultural3
puerto3
drinking3
quality3
hemisphere3
view3
civilian3
following3
postal3
measurescommittee3
crime3
terrorism3
higher3
overview3
communities3
mineral3
capabilities3
investor3
appropriations3
richard3
middle3
roles3
resource3
homelessness3
steps3
sbas3
subcommittee3
construction3
risk3
u0026middot3

Who hosts House.gov?

House.gov Hosting Provider Information

Hosted IP Address:34.194.109.118
Hosted Hostname:ec2-34-194-109-118.compute-1.amazonaws.com
Service Provider:AMAZON-AES
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4728
Webserver Software:Not Applicable

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for House.gov

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Security-Policy: frame-ancestors 'none'
Strict-Transport-Security: max-age=31536000; includeSubDomains
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-XSS-Protection: 1
X-Drupal-Dynamic-Cache: UNCACHEABLE
Link:; rel="shortlink", ; rel="canonical"
X-UA-Compatible: IE=edge
Content-Language: en
Last-Modified: Mon, 21 Jun 2021 16:00:10 GMT
ETag: "1624291210"
X-Generator: Drupal 8 (https://www.drupal.org)
X-Drupal-Cache: HIT
Content-Type: text/html; charset=UTF-8
X-Varnish: 10763220 512695
Accept-Ranges: bytes
Content-Encoding: gzip
Content-Length: 51971
Cache-Control: public, private, max-age=1
Expires: Mon, 21 Jun 2021 16:56:53 GMT
Date: Mon, 21 Jun 2021 16:56:52 GMT
Connection: keep-alive
Vary: Accept-Encoding

House.gov Domain Nameserver Information

HostIP AddressCountry
pdns109.ultradns.biz 156.154.66.109
pdns109.ultradns.net 156.154.65.109
pdns109.ultradns.com 156.154.64.109
pdns109.ultradns.org 156.154.67.109
oxygen2.house.gov 184.105.22.101
oxygen.house.gov 216.218.141.197


Need to find out who hosts House.gov?


Domain Registration (WhoIs) information for House.gov

 % DOTGOV WHOIS Server ready
Domain Name: HOUSE.GOV
Status: ACTIVE

>>> Last update of whois database: 2021-03-21T19:26:47Z

Websites with Similar Names

House-143.com
Metal band from another dimension - Divine Anger
House-2-home.net
house-2-home.net
House-49233.live
house-49233.live - Registered at Namecheap.com
House-55.com
HOUSE GO GO
House-8.com
神奈川県のハウスクリーニング大掃除はハウスエイト
House-8090.com
娴﹀彂褰╃エ_棣栭〉_娴﹀彂褰╃エ瀹樼綉

Recently Updated Websites

Anupamenterprise.in (3 minutes 40 seconds ago.)Ariashospital.com (13 minutes 35 seconds ago.)Stormproof-yourroof.com (24 minutes 35 seconds ago.)New-gbwhatsapp.com (35 minutes 39 seconds ago.)Health.grid.id (42 minutes 7 seconds ago.)Bgcoatings.com.au (45 minutes ago.)Deadsexyoverland.com (46 minutes 59 seconds ago.)Samadhanindia.com (47 minutes ago.)Whitesnursery.com (47 minutes 3 seconds ago.)Trestingpain.com (47 minutes 5 seconds ago.)Dewereldvanbruegel.com (47 minutes 6 seconds ago.)Dohaonthego.com (47 minutes 6 seconds ago.)Cqkailang.com (47 minutes 7 seconds ago.)Opt-media.net (47 minutes 15 seconds ago.)Collabcreativegroup.com (47 minutes 16 seconds ago.)Reptileswap.com (47 minutes 20 seconds ago.)Corenpr.gov.br (47 minutes 20 seconds ago.)Reach.org (47 minutes 22 seconds ago.)Kenyastax.com (47 minutes 27 seconds ago.)Topnotchnow.com (47 minutes 27 seconds ago.)Churiwala.com (47 minutes 28 seconds ago.)Thedentaldesignstudio.com (47 minutes 29 seconds ago.)Amdistributori.it (47 minutes 32 seconds ago.)Lutingao.com (47 minutes 34 seconds ago.)Savagejewelryboutique.com (47 minutes 35 seconds ago.)Tuvanbaohiemonline.com (47 minutes 35 seconds ago.)Attitudeinstitute.com (47 minutes 36 seconds ago.)Panamapapers.top (47 minutes 40 seconds ago.)Manyload.com (47 minutes 41 seconds ago.)Fetch-retirement.zone (47 minutes 42 seconds ago.)

Recently Searched Keywords

wiggle room (1 second ago.)31 th3 bn (1 second ago.)rei zero (3 seconds ago.)promotions aprs-vente (3 seconds ago.)von deinem ausbildungsbetrieb (3 seconds ago.)嫩妹福利 (3 seconds ago.)mobil ini (4 seconds ago.)grunty i działki (6 seconds ago.)home and garden (6 seconds ago.)hyperthyroid (7 seconds ago.)8378220500 8378280000 (7 seconds ago.)成人向遊戲專區 (7 seconds ago.)market vending (8 seconds ago.)arvarazs.hu (9 seconds ago.)productslinkedinlinkedin social (9 seconds ago.)my favorite luxury hotels featured on business insider (9 seconds ago.)new masters club loyalty program overview (9 seconds ago.)3mm black edge (9 seconds ago.)produkty pszczele (9 seconds ago.)dr.ceuracle (10 seconds ago.)kriptovalute (10 seconds ago.)2 bnh 12 (11 seconds ago.)propertunities contact number (11 seconds ago.)customer login (11 seconds ago.)total change in entropy (12 seconds ago.)et accumsan et (14 seconds ago.)звездные бои насмерть 1, 2, 3, 4, 5, 6 сезон (14 seconds ago.)iplticket.co.in (14 seconds ago.)ksbw (15 seconds ago.)prin (15 seconds ago.)