House.govHouse.gov

Add a review Follow site

Homepage | house.gov

Safety: High trust score

Year Founded: 2021

Global Traffic Rank: 703

Estimated Worth: $22,982,400

Category: Law and Government > Government

Expand details Change category Claim this site

house

Useful Searches

Domain summary

Last updated	2021-06-21
Domain label	house
Domain extension	gov
Global Traffic Rank	703
Statvoo Rating	A
Trust Score	High trust score
Estimated worth	$22,982,400
Estimated daily income	$21,280
Estimated monthly income	$647,267

Frequently Asked Questions (FAQ)

Q: When was House.gov registered?

A: House.gov was registered 10 months, 4 weeks, 6 hours, 18 minutes, 44 seconds ago on Monday, June 21, 2021.

Q: When was the WHOIS for House.gov last updated?

A: The WHOIS entry was last updated 10 months, 4 weeks, 6 hours, 18 minutes, 44 seconds ago on Monday, June 21, 2021.

Q: What are House.gov's nameservers?

A: DNS for House.gov is provided by the following nameservers:

pdns109.ultradns.biz
pdns109.ultradns.net
pdns109.ultradns.com
pdns109.ultradns.org
oxygen2.house.gov
oxygen.house.gov

Q: Who is the registrar for the House.gov domain?

A: The domain has been registered at .

Q: What is the traffic rank for House.gov?

A: House.gov ranks 703 globally on Alexa. House.gov has a High trust score, and a Statvoo Rank of A.

Q: How many people visit House.gov each day?

A: House.gov receives approximately 2,660,028 visitors and 21,280,224 page impressions per day.

Q: What IP address does House.gov resolve to?

A: House.gov resolves to the IPv4 address 34.194.109.118.

Q: In what country are House.gov servers located in?

A: House.gov has servers located in the United States.

Q: What webserver software does House.gov use?

A: House.gov is powered by webserver.

Q: Who hosts House.gov?

A: House.gov is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.

Q: How much is House.gov worth?

A: House.gov has an estimated worth of $22,982,400. An average daily income of approximately $21,280, which is roughly $647,267 per month.

House.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

House.gov Free SEO Report

Website Related Search Terms

Website Inpage Analysis for House.gov

H1 Headings

2 :

Legislative Activity
House Overview

H2 Headings

36 :

Most Recent Votes
Search Congress.gov
Representatives
View Representatives by State
Leadership
Speaker of the House: Rep. Nancy Pelosi
Democratic Leadership
Republican Leadership
Committees
Officers and Organizations
Chaplain of the House
Chief Administrative Officer
Clerk of the House
Sergeant at Arms
General Counsel
Historian of the House
Inspector General
Office of Congressional Ethics
Parliamentarian of the House
Legislative Counsel
Congressional Partners
Architect of the Capitol
Capitol Police
Congressional Budget Office
Government Accountability Office
Government Printing Office
Library of Congress
National Archives
United States Senate
Public Disclosure
Financial Disclosure Reports
Foreign Travel Reports
Gifts and Travel Filings
Legal Expense Fund Disclosures
Statement of Disbursements
Life at the House

H3 Headings

8 :

Majority Leader
Majority Whip
Assistant Speaker
Democratic Caucus Chairman
Republican Leader
Republican Whip
Republican Conference Chairman
Republican Policy Committee Chairman

H4 Headings

8 :

Rep. Steny Hoyer
Rep. James Clyburn
Rep. Katherine Clark
Rep. Hakeem Jeffries
Rep. Kevin McCarthy
Rep. Steve Scalise
Rep. Liz Cheney
Rep. Gary Palmer

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

382:

Show 377 more items

Links - Internal (nofollow)

Links - Outbound

29:

Show 24 more items

Links - Outbound (nofollow)

Keyword Cloud for House.gov

reauthorizationstudentsstates capitolsecurity 1000 aminfrastructureact hrsystemservicescommitteethroughappropriationssubcommittee on defense300 pm fiscalnatural resourcessubcommitteeexamining the policiesforeign1000 am usservicesfull committeeinternational developmentfyexpandinggeorgiamodernization2021 timeiraqarmyrequestcommitteeus departmentpuerto ricofloor proceedingsenvironmentalmiddle1100 am fy22innovativechildpm creatingaffairssubcommittee on europeemploymentresources 200 pmdrinking watervisitorsvirginiasopportunity actchildrenfriday junecapabilitiessessionaffairssubcommittee on economicrequestcommittee on armedcapital accessact of 2021committeehomeland securityjohnfuturecreditsteveeurope energymresourcessubcommitteesupplytechnologies and informationmilitary constructionmaritimehousesupporteducation labormeanssecuritypm virtualdanfiscalbudgetcommitteehomelessnessoverviewprogramscommitteeinterfere with freerepealservicessubcommittee on oversightchairman repserviceafricaeconomic growthunited states codeusespeakeret session 300international economic policyprioritiesjudiciarysubcommitteetechnologysubcommittee10economic developmenthearingcommitteecarecommitteeservices educationselectstates codeam departmentimagesvarforcesohioseacommitteeprotection and commercedefensebriandonaldbudgetreadinesswaterunited states capitolus12water oceansreform 1000migration and internationalcivil rightshouse administrationsubcommittee400 pmrequest for militarydelayscommunitiesauthorizationyear 2022committeerepresentativeballotcommitteejimpm fiscaltime etfairconstitutionpm legislative hearingreviewappropriationssubcommitteeprofilesclimate crisiscommitteearmedeconomic policycommunityiowascotttheiramendmentvirtual hearing15january 6th attackour19fridayimpacteducation and workforcepm hruse of militarymarkopportunity act reauthorizationservices 1200 pmsystemscivil libertiescommercesubcommitteesmallrichardotherhealthham examiningforces 1100national parkspeteupleadertexas930 amactivityaffairs 1000 amindigenous peoplesagriculturalrelatedillinoissearchr 1187responsenational securityarmsresources related1000 am fyeducationalus engagementjoe09005tuesday mayopportunitiessouth carolinaoceans and wildlifefloorrules18recentpolicy 1000 amcommittee 1200public buildingsmichaelnorthrequest1000 amframeworkamscience foundationcoastsession 300veterans039 affairs 1000corporateoversight and reformsubcommitteeworkforcecommerce 1100improvingrecent votespassagetechnology 1100daycommittee on appropriationssubcommitteeaddressinglessonscaribbeancommitteehybrid hearingtechnologysubcommittee on researcheuropetitle 5 unitedmarkupprotectionaircommerce 1100 amam membercongressionalwestern hemisphere civilianservicesfull committee 1200act reauthorizationpotentialengagementspace and technologyinstitutionsfriday may71000 am hrtacticalwatchcommercesubcommittee on healthandyforceborder securitymikehybridduringsecretaryfinancial servicesfullneedhuman servicesallcommerceflorida2021 time ethomeland security 1000mexicoeducational resources relatedwomennevadacivilnebraskaransomwareaffairssubcommitteefy 2022innovationforeign affairssafeinformationalabamacrime3presidentsappropriationssubcommittee on financialwest virginialaborsubcommittee on higherpolicedata and educationallibertiestitle 5sergeant at armsnewrural5 unitednationalfuture actsecuritysubcommitteebuildingsfy22space and technologysubcommitteeaviationelectedappropriationspeoplesqualitywisconsinconventionun convention1187 failedhouse floornatural resourcesrequestcommittee on appropriationssubcommitteerisknational sciencenoprogrammondaylandgregoryinvestmentpostalbusinesssubcommitteeappropriationssubcommittee homeland securityfreeaccountabilitylveterans039 affairsspacecommitteetransportationcivilianlaw17energycommitteeh r 1187medialaborsubcommitteenew mexicohomeland securitysubcommittee1200 pmthursdaycovid19 pandemiccommitteecurrentbased ordercommercesubcommittee on consumerbudget hybridcommitteeconstitution civil rightskansasways and meanssubcommitteebuildinglabortechnologysession 930amendment noexaminationcovid19parksagainst iraq resolutionresearch and technologyletterpresident2yorkpolicies and prioritiesforwardcommitteetime et sessionaccessrules based orderpartair forceservicessubcommittee on cyberimpactsamericanways and meansasiahearingrickselect committeesecurity migrationinvestor0616 hfamiliesrightsexaminingbudget requestcommitteeendingsession 300 pmdataleadership committeesfiscal yearfollowingdavidwroad1200 pm virtualfranklabor 1200 pmwildlifeiraq resolution2021committeemilitaryroleshigher educationservicessubcommittee on seapowernaturaladministrationsoregondeconomic development publicu0026middotlouisianaeconomic opportunityappropriationssubcommittee homelandprogramscommittee on armedtomagreeingoperationssession u0026middotartifactsfree and faircompetitionstate foreign operationsgrowth taxhomelandartifacts images historicalprojection forces 1100growthcyber innovative technologiesservicessubcommittee on strategic230 pminvestigationsveterans039pm examiningdaycommitteeactintelligencenational independenceconstitution civiljanuary 6thpm2021 hrrulecommissionhuman services educationsenateearlyfy 2022 budgetdrinkingstatessession 900 ammoststaffscience spacebudget requestdepartment of defenseeducational resourcessafetycreating22 2021codeentrepreneurshipjerseyforces 1100 amworkersappropriationssubcommittee on state2021replgbtqiauthorization for usewednesdayhearing on hrcvirtualindependencehigherinvestingstrategicrepresentativesmanagementgovernmentprofiles artifacts imagesrelated agenciesunited statescitizenshipmakinggeneral governmentmike californiaenvironmentclimateperspectivesnational independence daysocialcaresession 1100 ammembers of congressinformation systemsconstructionethistoricalhistorical essaysam member daycommittee1100 am maritimesubcommitteechaplainstrategyjameslabor healthforce against iraqr 1187 failedbackcommitteescommittee 1000 amstatericoamericacommitteemissourih rpoliciessimplification actsession 900rules basedadministrationsubcommitteechange300 pm creatingmemberpreparednessvoting in americaforestsdevelopment public buildingsconsumer protectionattackservices and generallegalmaritime securityreform 1000 amservicecommitteeresveterans039 affairssubcommitteeorderdemocraticseapower and projectiondepartment of energycommitteechris newtimseapowerresourceactcommitteeindopacificrobertreformeducation laborsubcommitteeagainstveterans affairsbillspennsylvaniaamerica the potentialrepeal the authorizationlabor 1200et session 930pm legislativeutaham us200 pmtax0900 ampipelineaffairssubcommittee on westernannofficerselectionsyearworkforce innovationmichiganpolicy 1000debbieron9capitolwestam buildingtennesseerepreadinesscommitteeproceedingsunaccompanieddepartmentoversightenergy and mineralrelated programsimages historicalsecurity 1000workforce investmentservicessubcommitteeglobalbuildlegislativequestionsam hybridam maritimeadvancingjuneet session 1100strategic forceseconomic growth tax11civilian securityofficeappropriationssubcommittee on laborveteransvotesrepublicanfair accessh reset session 10000616 h rdevelopment publicdonessays dataservicesam virtualoperations and relatedsimplificationtreasuryyear 202214house of representativestechnology 1100 amcreating a frameworkoversight and reformagencypacificam virtual hearingpm departmentpm virtual hearinghearingcommittee on appropriationssubcommitteefinancial institutions0616modernization of congresssmall businesssubcommitteesession 1000 amtransportation and infrastructuresubcommitteereportsfiscal year 2022committeejointsmall businessprojectionimmigrationmarylandcleanoklahoma1015 amtechnologiesservices 1200lastwaysenvironment and climatefy22 budgetinnovative technologiese1000 am oversightchairmanpassedet session 900consumerampagencies2022 budget hybridcommitteewednesday juneresearchforeign operationsspacepm oversightcapitol policeam the bidentax and capitalbidenjanuaryeconomicdevelopmentresourcessubcommittee on energymilitary force againsthemispherehemisphere civiliandisclosure simplification actprotectingmaymeanssubcommitteeclerkterrorismcyber innovativeeducation and relatednational science foundationcaliforniaresources 200botanicindianaservicesfulllandsinternational economiclegislative hearingcapitalpeterexamining the rolecrisisinfrastructuresubcommitteesession 1000images historical essayskevinessaysmississippidayminnesotatravelpm fiscal yearapriljudiciaryfailed900 amemergency managementdisclosure simplificationcoloradocybersecurity2022 budget request1am votingkentuckyagainst iraqindigenousresolutionupdateactcommittee on rulestuesdayfinancial servicessubcommitteevotingequityjoint committeenew jerseyarmed services8retirementoversight hearingcommitteewildlife wednesdayam fyorder in spacecommitteecentraldisclosureeducationviewcivilian security migrationstepsemergencybiden administrationsservicessubcommittee on readinessclimate changeenergycommittee on science16ballotcommittee on househouse administrationscienceam maritime securityconnecticutcarolinaprogramscommittee on smallpolicyet sessiondanielnational parks forestsenvironment and cyberarmed servicessubcommitteeparks forestsjmarkup hrhistorical essays dataadamopportunityrepresentatives leadershipmilitary force6grantmigrationpandemiccommittee1100 am departmentresourcessubcommittee on nationalpuertomineralact of 2021terrorism and homelandforce againstgtuesday junehemisphere civilian securityjudiciarysubcommittee on immigrationmeasurescommitteesecondaryam fy 2022community developmentchrisadministrativecyber6thorganizationswashingtonfederaltitlerepresentatives leadership committeesframework for rulesmonday maysergeantdrugreadiness 300role300 pmbillinclusionyourfinancial servicesfull committee1000 am virtual1100 amhybridcommitteefiscal year 2022rstate foreignwesterncommittee 1000financialthursday mayfoundationam fy22am covid19buildings and emergencymember daycommitteeforeign affairs 1000committee 1200 pmvaenergy and commercesubcommitteehuman6th attackeducation labor 120040arizonatroyjobsprofiles artifactswestern hemisphere2022 budgetinterferepublic landsresourcesforests and publichousingsouth13membersenergy the environmentcoronavirus1000 am memberreformsubcommittee2022committeeinfrastructuresubcommittee on economicagricultureoceansbusinesssubcommittee on economicsbasmineral resourcesunjusticelegislative activityaffairs 1000commercesubcommittee on environmentresourcessubcommittee on indigenoustimeracial5 united statessession 1100pm jointthursday junebasedunitedprogramsmorearkansasyear 2022 budgethroversight and investigationswednesday mayfinancial servicesnancyadministrationjudiciarysubcommittee on crimeinnovation and opportunitydiversityam hrforeign affairssubcommitteeam oversightcaribbeancommittee on foreignamericaindependence dayrights and civilcrime terrorismcounterterrorismpublicfoodfy22 budget requestcommitteeartifacts imagesgeneralnextmost recentblackprojection forcesthomasrecoverybusinessnorth carolina100 pmpursuantinternationalenergyaffairsjrimprovementchallengessession 930 amborderadministrationsubcommittee on electionsresourcessubcommittee on waterimmigration and citizenshipnew yorktedhealth and humancongress1030 amleadershipmassachusettsreadiness 300 pm

Longtail Keyword Density for House.gov

Keywords	Occurences
2021 time et	40
time et session	40
fiscal year 2022	20
session 1000 am	15
et session 1000	15
year 2022 budget	14
pm virtual hearing	13
energy and commercesubcommittee	12
space and technologysubcommittee	11
oversight and reform	11
2022 budget request	10
1200 pm virtual	10
act of 2021	10
transportation and infrastructuresubcommittee	8
oversight and investigations	8
ways and meanssubcommittee	7
session 1100 am	7
et session 1100	7
affairs 1000 am	7
servicessubcommittee on readiness	7
h r 1187	6
am member daycommittee	6
06-16 h r	6
services and general	6
ways and means	6
seapower and projection	6
financial servicesfull committee	6
pm fiscal year	6
united states code	6
modernization of congress	6
environment and cyber	5
energy the environment	5
affairssubcommittee on europe	5
fy22 budget requestcommittee	5
pm legislative hearing	5
oversight and reformsubcommittee	5
am virtual hearing	5
appropriationssubcommittee on financial	5
health and human	5
1000 am virtual	5
rights and civil	5
resources 200 pm	4
requestcommittee on appropriationssubcommittee	4
resourcessubcommittee on water	4
servicessubcommittee on strategic	4
voting in america	4
commercesubcommittee on consumer	4
administrationsubcommittee on elections	4
programscommittee on armed	4
foreign affairs 1000	4
reform 1000 am	4
hearing on hr	4
examining the policies	4
policies and priorities	4
requestcommittee on armed	4
national science foundation	4
operations and related	4
state foreign operations	4
appropriationssubcommittee on state	4
security 1000 am	4
homeland security 1000	4
1000 am hr	4
constitution civil rights	4
session 900 am	4
programscommittee on small	4
et session 900	4
house of representatives	4
et session 930	4
session 930 am	4
oceans and wildlife	4
protection and commerce	4
technologysubcommittee on research	4
300 pm fiscal	4
forces 1100 am	4
servicessubcommittee on seapower	4
et session 300	4
session 300 pm	4
servicessubcommittee on cyber	4
cyber innovative technologies	4
research and technology	4
department of defense	4
technologies and information	4
1000 am oversight	4
services 1200 pm	4
images historical essays	3
1000 am fy	3
education and related	3
human services education	3
repeal the authorization	3
appropriationssubcommittee on labor	3
daycommittee on appropriationssubcommittee	3
am fy 2022	3
committee 1000 am	3
1000 am us	3
commerce 1100 am	3
authorization for use	3
national parks forests	3
forests and public	3
1000 am member	3
use of military	3
national independence day	3
military force against	3
disclosure simplification act	3
title 5 united	3
appropriationssubcommittee homeland security	3
request for military	3
force against iraq	3
appropriationssubcommittee on defense	3
fy 2022 budget	3
artifacts images historical	3
1100 am fy22	3
profiles artifacts images	3
2022 budget hybridcommittee	3
data and educational	3
hearingcommittee on appropriationssubcommittee	3
educational resources related	3
1100 am department	3
r 1187 failed	3
5 united states	3
space and technology	3
historical essays data	3
resourcessubcommittee on national	3
against iraq resolution	3
representatives leadership committees	3
energy and mineral	3
am maritime security	3
framework for rules	3
creating a framework	3
300 pm creating	3
veterans039 affairs 1000	3
act of 2021committee	3
energycommittee on science	3
department of energycommittee	3
fiscal year 2022committee	3
tax and capital	3
economic growth tax	3
businesssubcommittee on economic	3
projection forces 1100	3
1100 am maritime	3
order in spacecommittee	3
buildings and emergency	3
development public buildings	3
economic development public	3
infrastructuresubcommittee on economic	3
immigration and citizenship	3
judiciarysubcommittee on immigration	3
servicessubcommittee on oversight	3
examining the role	3
labor 1200 pm	3
education labor 1200	3
technology 1100 am	3
committee 1200 pm	3
servicesfull committee 1200	3
rules based order	3
america the potential	3
resourcessubcommittee on energy	3
migration and international	3
environment and climate	3
commercesubcommittee on environment	3
education and workforce	3
laborsubcommittee on higher	3
opportunity act reauthorization	3
innovation and opportunity	3
terrorism and homeland	3
judiciarysubcommittee on crime	3
resourcessubcommittee on indigenous	3
am the biden	3
policy 1000 am	3
international economic policy	3
civilian security migration	3
interfere with free	3
hemisphere civilian security	3
western hemisphere civilian	3
affairssubcommittee on western	3
caribbeancommittee on foreign	3
commercesubcommittee on health	3
sergeant at arms	3
affairssubcommittee on economic	3
actcommittee on rules	3
united states capitol	3
january 6th attack	3
readiness 300 pm	3
ballotcommittee on house	3
free and fair	3
members of congress	3
1000 am	70
1100 am	56
2021 time	40
time et	40
et session	40
200 pm	35
1200 pm	33
new york	27
300 pm	27
fiscal year	25
100 pm	25
armed servicessubcommittee	24
year 2022	20
foreign affairssubcommittee	18
virtual hearing	18
2022 budget	17
united states	16
natural resourcessubcommittee	15
session 1000	15
science space	14
north carolina	14
pm virtual	13
financial servicessubcommittee	12
homeland security	12
budget request	12
new jersey	12
1030 am	11
house administration	10
education laborsubcommittee	10
homeland securitysubcommittee	10
small businesssubcommittee	10
small business	9
related agencies	9
budget requestcommittee	9
consumer protection	8
legislative hearing	8
foreign affairs	8
h r	8
financial services	8
natural resources	8
south carolina	7
civil rights	7
projection forces	7
06-16 h	7
us department	7
am hr	7
2021 hr	7
am examining	7
am member	7
affairs 1000	7
session 1100	7
armed services	7
1015 am	7
financial servicesfull	6
230 pm	6
veterans039 affairssubcommittee	6
education labor	6
states code	6
r 1187	6
climate change	6
pm hr	6
member daycommittee	6
human services	6
general government	6
fy22 budget	6
pm fiscal	6
servicesfull committee	6
strategic forces	5
europe energy	5
joint committee	5
international development	5
930 am	5
900 am	5
am department	5
am virtual	5
capitol police	5
am oversight	5
biden administrations	5
civil liberties	5
pm legislative	5
related programs	5
veterans039 affairs	5
act hr	4
national science	4
services 1200	4
reform 1000	4
economic opportunity	4
national security	4
security 1000	4
am hybrid	4
constitution civil	4
forces 1100	4
session 930	4
resources 200	4
wednesday may	4
h res	4
state foreign	4
maritime security	4
wednesday june	4
science foundation	4
tuesday june	4
foreign operations	4
veterans affairs	4
session 300	4
water oceans	4
monday may	4
community development	4
fy 2022	4
opportunity act	4
tuesday may	4
national parks	4
thursday may	4
400 pm	4
select committee	4
house administrationsubcommittee	4
information systems	4
innovative technologies	4
pm oversight	4
january 6th	4
cyber innovative	4
session 900	4
us engagement	3
parks forests	3
oversight hearingcommittee	3
am voting	3
climate crisis	3
drinking water	3
military construction	3
am fy22	3
chris new	3
public lands	3
puerto rico	3
new mexico	3
mike california	3
educational resources	3
west virginia	3
amendment no	3
resources related	3
essays data	3
1187 failed	3
chairman rep	3
historical essays	3
images historical	3
artifacts images	3
0900 am	3
title 5	3
independence day	3
friday june	3
national independence	3
iraq resolution	3
against iraq	3
force against	3
military force	3
simplification act	3
disclosure simplification	3
profiles artifacts	3
pm joint	3
thursday june	3
budget hybridcommittee	3
am building	3
air force	3
pm department	3
5 united	3
representatives leadership	3
hybrid hearing	3
public buildings	3
fair access	3
based order	3
rules based	3
pm creating	3
markup hr	3
year 2022committee	3
capital access	3
growth tax	3
economic growth	3
un convention	3
am maritime	3
emergency management	3
development public	3
friday may	3
economic development	3
labor 1200	3
technology 1100	3
wildlife wednesday	3
border security	3
committee 1200	3
22 2021	3
house floor	3
most recent	3
recent votes	3
floor proceedings	3
legislative activity	3
readiness 300	3
6th attack	3
appropriationssubcommittee homeland	3
workforce innovation	3
am us	3
services education	3
labor health	3
am fy	3
committee 1000	3
commerce 1100	3
financial institutions	3
mineral resources	3
future act	3
workforce investment	3
higher education	3
act reauthorization	3
crime terrorism	3
states capitol	3
indigenous peoples	3
policy 1000	3
economic policy	3
international economic	3
security migration	3
civilian security	3
hemisphere civilian	3
western hemisphere	3
pm examining	3
leadership committees	3
am covid-19	3
covid-19 pandemiccommittee	3
session u0026middot	3
am	165
pm	139
hr	123
0	70
1	56
2	55
california	55
house	50
new	47
session	45
oversight	45
act	45
time	42
et	40
financial	40
committee	38
texas	37
foreign	37
budget	36
servicessubcommittee	36
hearing	36
3	35
energy	34
4	33
armed	31
security	29
department	29
florida	27
5	27
6	27
education	27
york	27
year	26
science	26
fiscal	25
7	25
small	24
natural	24
affairssubcommittee	24
appropriationssubcommittee	23
homeland	23
national	22
examining	21
services	21
carolina	21
development	20
us	20
economic	20
public	19
health	19
may	19
united	19
north	19
related	19
june	18
virtual	18
illinois	18
pennsylvania	18
climate	18
congress	18
affairs	17
space	17
resources	17
ohio	16
states	16
protection	16
georgia	15
resourcessubcommittee	15
virginia	15
rights	15
administration	15
representatives	15
forces	15
policy	14
reform	14
civil	14
michigan	14
congressional	13
investigations	13
h	13
workforce	13
business	13
technology	13
legislative	13
transportation	13
environment	13
labor	13
america	13
international	13
ways	13
judiciarysubcommittee	13
request	13
infrastructure	12
washington	12
information	12
rules	12
actcommittee	12
cyber	12
innovation	12
covid-19	12
defense	12
military	12
priorities	12
jersey	12
commercesubcommittee	12
programs	12
capitol	11
consumer	11
global	11
future	11
veterans039	11
technologysubcommittee	11
8	11
access	11
john	11
david	10
code	10
rep	10
businesssubcommittee	10
r	10
response	10
management	10
laborsubcommittee	10
fy22	10
addressing	10
securitysubcommittee	10
operations	10
mike	10
water	10
research	10
federal	10
veterans	9
arizona	9
indiana	9
modernization	9
requestcommittee	9
opportunity	9
massachusetts	9
agencies	9
tennessee	9
government	9
accountability	9
title	9
search	9
member	9
programscommittee	9
tuesday	9
readiness	9
wednesday	9
human	9
state	9
thursday	9
joint	9
employment	9
infrastructuresubcommittee	8
general	8
wisconsin	8
leadership	8
friday	8
e	8
emergency	8
06-16	8
against	8
your	8
south	8
missouri	8
commerce	8
building	8
michael	8
office	8
amendment	8
minnesota	8
maryland	8
projection	8
members	7
equity	7
tom	7
tax	7
means	7
day	7
colorado	7
select	7
our	7
jim	7
9	7
alabama	7
daycommittee	7
force	7
voting	7
bill	7
meanssubcommittee	7
bills	7
policies	7
crisis	7
europe	7
markup	6
servicesfull	6
biden	6
part	6
10	6
cybersecurity	6
strategic	6
kentucky	6
potential	6
steve	6
louisiana	6
l	6
creating	6
res	6
reports	6
recent	6
administrations	6
jr	6
floor	6
change	6
improving	6
law	6
opportunities	6
presidents	6
intelligence	6
monday	6
other	6
protecting	6
var	6
through	6
social	6
committees	6
rural	6
senate	6
role	6
seapower	6
border	6
11	6
s	6
speaker	6
air	6
attack	5
6th	5
january	5
maritime	5
justice	5
oregon	5
americacommittee	5
liberties	5
hearingcommittee	5
12	5
passed	5
disclosure	5
american	5
investing	5
clerk	5
environmental	5
impacts	5
review	5
proceedings	5
elections	5
update	5
13	5
hybrid	5
oklahoma	5
next	5
educational	5
historical	5
april	5
police	5
fair	5
workers	5
agreeing	5
advancing	5
scott	5
their	5
republican	5
housing	5
reformsubcommittee	5
wildlife	5
independence	5
need	5
mark	5
judiciary	5
c	5
arkansas	5
systems	5
no	5
drug	5
james	5
institutions	5
andy	5
diversity	5
students	5
connecticut	5
growth	5
engagement	5
nevada	4
brian	4
iowa	4
president	4
army	4
pipeline	4
road	4
clean	4
investment	4
14	4
watch	4
activity	4
land	4
agriculture	4
commission	4
failed	4
program	4
coronavirus	4
representative	4
current	4
fy	4
secondary	4
officers	4
robert	4
debbie	4
use	4
resolution	4
15	4
joe	4
administrationsubcommittee	4
d	4
improvement	4
africa	4
chairman	4
children	4
perspectives	4
service	4
forwardcommittee	4
technologies	4
innovative	4
data	4
competition	4
oceans	4
foundation	4
administrative	4
care	4
capital	4
recovery	4
legal	4
back	4
racial	4
build	4
grant	4
immigration	4
reauthorization	4
challenges	4
chris	4
indo-pacific	4
ann	4
asia	4
central	4
ending	4
inclusion	4
mississippi	4
all	4
constitution	4
kansas	4
corporate	4
migration	4
organizations	4
impact	4
western	4
pandemiccommittee	4
j	4
parks	4
utah	4
aviation	4
entrepreneurship	4
16	4
indigenous	4
community	4
more	4
peoples	4
kevin	4
budgetcommittee	4
va	4
m	3
thomas	3
passage	3
0900	3
donald	3
chaplain	3
w	3
botanic	3
dan	3
west	3
pursuant	3
gregory	3
nancy	3
nebraska	3
frank	3
pete	3
don	3
ron	3
images	3
troy	3
g	3
mexico	3
peter	3
artifacts	3
ted	3
leader	3
elected	3
essays	3
travel	3
tim	3
daniel	3
profiles	3
adam	3
rick	3
order	3
rule	3
framework	3
energycommittee	3
system	3
last	3
2021committee	3
letter	3
2021rep	3
retirement	3
expanding	3
carecommittee	3
ransomware	3
based	3
strategy	3
spacecommittee	3
black	3
staff	3
interfere	3
free	3
ballotcommittee	3
early	3
during	3
delays	3
making	3
support	3
2022committee	3
17	3
servicecommittee	3
unaccompanied	3
up	3
visitors	3
media	3
questions	3
sergeant	3
arms	3
votes	3
most	3
18	3
servicescommittee	3
19	3
safety	3
preparedness	3
jobs	3
families	3
citizenship	3
buildings	3
counterterrorism	3
un	3
convention	3
seacommittee	3
pacific	3
supply	3
food	3
caribbeancommittee	3
rico	3
secretary	3
safe	3
examination	3
credit	3
amp	3
child	3
treasury	3
agency	3
forests	3
lands	3
tactical	3
coast	3
readinesscommittee	3
democratic	3
hybridcommittee	3
lessons	3
lgbtqi	3
simplification	3
repeal	3
authorization	3
iraq	3
women	3
agricultural	3
puerto	3
drinking	3
quality	3
hemisphere	3
view	3
civilian	3
following	3
postal	3
measurescommittee	3
crime	3
terrorism	3
higher	3
overview	3
communities	3
mineral	3
capabilities	3
investor	3
appropriations	3
richard	3
middle	3
roles	3
resource	3
homelessness	3
steps	3
sbas	3
subcommittee	3
construction	3
risk	3
u0026middot	3

Who hosts House.gov?

House.gov Hosting Provider Information

Hosted IP Address:	34.194.109.118
Hosted Hostname:	ec2-34-194-109-118.compute-1.amazonaws.com
Service Provider:	AMAZON-AES
Hosted Country:	US
Location Latitude:	39.0481
Location Longitude:	-77.4728
Webserver Software:	Not Applicable

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name

Percentage

Unknown

21.9161%

GOOGLE

14.0532%

AS-26496-GO-DADDY-COM-LLC

3.4879%

NAMECHEAP-NET

3.1470%

AMAZON-AES

2.2136%

GoDaddy.com, LLC

2.0287%

UNIFIEDLAYER-AS-1

1.9645%

Fara Negar Pardaz Khuzestan

1.6143%

CONFLUENCE-NETWORK-INC

1.4660%

1&1 Internet AG

1.3358%

HTTP Header Analysis for House.gov

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Content-Security-Policy:	frame-ancestors 'none'
Strict-Transport-Security:	max-age=31536000; includeSubDomains
X-Content-Type-Options:	nosniff
X-Frame-Options:	DENY
X-XSS-Protection:	1
X-Drupal-Dynamic-Cache:	UNCACHEABLE
Link:	; rel="shortlink", ; rel="canonical"
X-UA-Compatible:	IE=edge
Content-Language:	en
Last-Modified:	Mon, 21 Jun 2021 16:00:10 GMT
ETag:	"1624291210"
X-Generator:	Drupal 8 (https://www.drupal.org)
X-Drupal-Cache:	HIT
Content-Type:	text/html; charset=UTF-8
X-Varnish:	10763220 512695
Accept-Ranges:	bytes
Content-Encoding:	gzip
Content-Length:	51971
Cache-Control:	public, private, max-age=1
Expires:	Mon, 21 Jun 2021 16:56:53 GMT
Date:	Mon, 21 Jun 2021 16:56:52 GMT
Connection:	keep-alive
Vary:	Accept-Encoding

House.gov Domain Nameserver Information

Host	IP Address	Country
pdns109.ultradns.biz	156.154.66.109
pdns109.ultradns.net	156.154.65.109
pdns109.ultradns.com	156.154.64.109
pdns109.ultradns.org	156.154.67.109
oxygen2.house.gov	184.105.22.101
oxygen.house.gov	216.218.141.197

Need to find out who hosts House.gov?

Domain Registration (WhoIs) information for House.gov

 % DOTGOV WHOIS Server ready
Domain Name: HOUSE.GOV
Status: ACTIVE

>>> Last update of whois database: 2021-03-21T19:26:47Z

Websites with Similar Names

House-143.com
Metal band from another dimension - Divine Anger

House-2-cash.com

House-2-home.net
house-2-home.net

House-2-om.com
Home Page

House-49233.live
house-49233.live - Registered at Namecheap.com

House-4u.de
HOUSE4U

House-55.com
HOUSE GO GO

House-8.com
神奈川県のハウスクリーニング大掃除はハウスエイト

House-800.com

House-8090.com
娴﹀彂褰╃エ_棣栭〉_娴﹀彂褰╃エ瀹樼綉

Recently Searched Keywords

wiggle room (1 second ago.), 31 th3 bn (1 second ago.), rei zero (3 seconds ago.), promotions aprs-vente (3 seconds ago.), von deinem ausbildungsbetrieb (3 seconds ago.), 嫩妹福利 (3 seconds ago.), mobil ini (4 seconds ago.), grunty i działki (6 seconds ago.), home and garden (6 seconds ago.), hyperthyroid (7 seconds ago.), 8378220500 8378280000 (7 seconds ago.), 成人向遊戲專區 (7 seconds ago.), market vending (8 seconds ago.), arvarazs.hu (9 seconds ago.), productslinkedinlinkedin social (9 seconds ago.), my favorite luxury hotels featured on business insider (9 seconds ago.), new masters club loyalty program overview (9 seconds ago.), 3mm black edge (9 seconds ago.), produkty pszczele (9 seconds ago.), dr.ceuracle (10 seconds ago.), kriptovalute (10 seconds ago.), 2 bnh 12 (11 seconds ago.), propertunities contact number (11 seconds ago.), customer login (11 seconds ago.), total change in entropy (12 seconds ago.), et accumsan et (14 seconds ago.), звездные бои насмерть 1, 2, 3, 4, 5, 6 сезон (14 seconds ago.), iplticket.co.in (14 seconds ago.), ksbw (15 seconds ago.), prin (15 seconds ago.),