Hurriyet.com.tr Review - Tüm gazete haberleri, internet haber ve makaleleri, köşe yazarları, en son haber ve son dakika gelişmeler Türkiye’nin Açılış Sayfası HÜRRİYET’te!551
Hurriyet.com.tr
5 out of 5 based on 1 user ratings.

Hurriyet.com.tr Website Analysis Summary

Hurriyet.com.tr  |  Tüm gazete haberleri, internet haber ve makaleleri, köşe yazarları, en son haber ve son dakika geliÅŸmeler TürkiyeÂ’nin Açılış Sayfası HÃœRRÄ°YETÂ’te!
High trust score  | 
Hrriyet - Haber, Son Dakika Haberler, Gncel Gazete Haberleri


Rank
640
Rating
B
Trust Score
High trust score
Estimated worth
$25,245,000
Estimated daily income
$23,375
Estimated monthly income
$710,990
Backlinks
0

Hurriyet.com.tr has a High trust score, and a Statvoo Rank of B.

Hurriyet.com.tr is hosted by DOGAN TV DIGITAL PLATFORM ISLETMECILIGI A.S. in Istanbul, Istanbul, Turkey, 34214.
Hurriyet.com.tr has an IP Address of 83.66.162.3 and a hostname of 83.66.162.3.

The domain hurriyet.com.tr was registered 201 decades 9 years 4 months ago by , it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 640 most popular site among over 300 million websites.

Hurriyet.com.tr has a total of 0 backlinks.

Hurriyet.com.tr gets approximately 2,921,875 unique visitors a day and 23,375,000 pageviews per day.

Hurriyet.com.tr has an estimated worth of $25,245,000.
An average daily income of approximately $23,375, which is wroughly $710,990 per month.

Whois information for hurriyet.com.tr

Full Whois Lookup for Hurriyet.com.tr Whois Lookup

Who hosts Hurriyet.com.tr?

Hurriyet.com.tr Web Server Information

Hosted IP Address:83.66.162.3
Hosted Hostname:83.66.162.3
Service Provider:DOGAN TV DIGITAL PLATFORM ISLETMECILIGI A.S.
Hosted Country:TurkeyTR
Location Latitude:41.0438
Location Longitude:28.8262
Webserver Software:Not Applicable

HTTP Header Analysis for Hurriyet.com.tr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Fri, 22 May 2015 13:35:56 GMT
Content-Length: 33451

Need to find out who hosts Hurriyet.com.tr?

Hurriyet.com.tr Free SEO Report

Website Inpage Analysis for Hurriyet.com.tr

H1 Headings:1
SON DAKİKA HABERLER
H2 Headings:1
Günlük Burç Yorumları
H3 Headings:0
H4 Headings:1
Tümü
H5 Headings:0
H6 Headings:0
Total IFRAMEs:3
Total Images:260
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Hurriyet.com.tr

iecontentswipper aremoveclickcontentnextsliderbuttonclickfunctionif cityid undefinednasliscontentcitycitysliderhtml citysliderhtmlile haber cekilirappendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction eindex classnameieprevbuttonvarvar iscontentcityatanrajaxurl httpgeolochurriyetcomtrapicountrytypehaber cekilirisiesliderdc7fb5yaztre iecontentswipper aremovevarbavurulargetsuccesska2311loop truepaginationbulletrender functionalm bavurulargetsuccess functiondatanewshtmldatatruepaginationbulletrender function indextr dataregion iscontentcityyeniswiperpaginationbulletactiveeachfunctionclassname return indexile haber6laniscontentcity var citysliderhtmlswipercontainerfunction isievar mynav navigatoruseragenttolowercasereturne iecontentswipperbaknmerak500px position relativeswiperpaginationbullets swiperpaginationbulletiecontentswippercssdisplayvar appendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctiontr dataregionfunctionerrblocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplayslider110645 swiperpaginationbulletsindex classname returncekilir ve objeyeappendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctionindex 1function indexswiperpaginationbullets swiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplayiframeswiperpaginationbullets swiperpaginationbulletactiveeachfunction eblocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay blockfunctionblocknextsliderbuttoncssdisplayconsolelogerrvarhabercekilir vehttpgeolochurriyetcomtrapicountrytypecitynewszindexvar mynavslider6bfc33nextsliderbutton ienextbuttonvarfunctiondatathishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctionolayne kadarbelliie10documentreadyfunction functiongeoloccountryiddata statusaremoveclickcontentnextsliderbuttonclickfunction eswiperpaginationbullets swiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction ebavurular ne zamane var appendforstatusthishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction e iecontentswippercnamereturn10 varnextsliderbutton ienextbuttonvar prevsliderbutton10 var nextsliderbuttonswiper ie10documentreadyfunctiontehaber cekilir veindex 1 swiperswiperbuttonprevspacebetweenolduif cityidreturn index 1yineblockfunction clickcontenthttpgeolochurriyetcomtrapicountrytype getsuccessgeolocusercityid3cityid 0 cityidfunctiondata if datacountrycodeundefined cityid cityidg252nfalseifgetsuccess functiondata iftruepaginationbulletrender function1 swiper ie10documentreadyfunctionfunctionerr consolelogerrvarswiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplayclassname returnbelli oldubscontrol citynews varvar citysliderhtml citysliderhtmlkayt1 swipermynavindexofmsiefunctionheight 500px positionswiperpaginationbulletiecontentswippercssdisplay0 cityid5undefinedfalseif isiecityid cityid 041 parseintmynavsplitmsie1blockfunctionne zamanfalseif isie isieprevsliderbutton ieprevbuttonvartruepaginationbulletrenderkadargeolocusercityid undefinedposition relativedataregion iscontentcity0dahaift252rkiye ka231ncobjeye atanrajaxurl httpgeolochurriyetcomtrapicountrytypee vargeoloccountryid triecontentswipper aremovevarswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunctionaremovevarpersonelnavigatoruseragenttolowercasereturnif datacountrycodee iecontentswipper aremoveclickcontentnextsliderbuttonclickfunctionparseintmynavsplitmsie1 falseif isiehttpgeolochurriyetcomtrapicountrytype getsuccess functiondatave objeyeswiper ie10documentreadyfunction functionbirswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction eisie varrelativemynavindexofmsie 1odatacountrycode tr231almaclassnameswiperprevsliderbutton ieprevbuttonvar swiperpageinationswipercontainer paginationcitynews var iscontentcityie10documentreadyfunctionistei ile habergeolocusercityid undefined geolocusercityidaremoveclickcontentnextsliderbuttonclickfunctionmynavindexofmsie 1 parseintmynavsplitmsie1500pxcityid 0ka231nc0slidesperview 1loopvar nextsliderbutton ienextbuttonvardatacountrycode tr dataregionisie isienavigatoruseragenttolowercasereturn mynavindexofmsie 1atanrajaxurl httpgeolochurriyetcomtrapicountrytype getsuccessdataregion iscontentcity varswiperpaginationbulletsfunction data statuscitysliderhtmlfunctiondata ifswiperbuttonnextprevbuttonienextbuttonvar prevsliderbuttonslider110645isie var mynavfunction isie varienextbuttonvar prevsliderbutton ieprevbuttonvardatacountrycodealmpositioniecontentswipper aremovevar trigerlinkobjeyeswiperpaginationbulletactiveeachfunction eblockprevsliderbuttoncssdisplay blockfunction clickcontentparseintmynavsplitmsie1b246l252mbscontrol citynewsileisteiswiperpaginationbullets swiperpaginationbulletactiveeachfunctionblockprevsliderbuttoncssdisplay blockfunctionnewshtml newshtmlmynavreturn indexdataregionbucityidiecontentswipper aremoveclickcontentnextsliderbuttonclickfunction evarwindownamespaceqistei ilesliderdc7fb5 swiperpaginationbulletsfunction index classnameswiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplaypersonel alm bavurularappendforesonve objeye atanrajaxurlcitysliderhtml citysliderhtml citysliderhtmlienextbuttonvarblockprevsliderbuttoncssdisplayfunction dataswiperpageinationmynav navigatoruseragenttolowercasereturn mynavindexofmsie0slidesperview1loopbavurular nerelative zindexk246t252swiperpaginationbulletactiveeachfunction e varcityid undefined cityidzamanswiperbuttonprevspacebetween 0slidesperviewbursif datacountrycode trtrigerlink2citylistcontentswiperpaginationbullets swiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunctioncityid undefined1loop truepaginationbulletrenderi231in1position relative zindexprevsliderbuttonneswipercontainer swiperwrapperpersonel almisie isie 10atanrajaxurl1 parseintmynavsplitmsie1 falseifiecontentswippervar nextsliderbuttonieprevbuttonvar swiperpageinationnavigatoruseragenttolowercasereturn mynavindexofmsiebscontrolvenextsliderbuttonstanbulundefined cityidmynav navigatoruseragenttolowercasereturnt252rkiyeparseintmynavsplitmsie1 falseifcityid cityid500px positionisie 10aremovevar trigerlinkswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e iecontentswipperobjeye atanrajaxurlvar citysliderhtmlnewheightie10documentreadyfunction function isieswiperwrapperundefined geolocusercityidthishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction eindexiscontentcity varcekilirswiperpaginationnextbuttonclickcontentfragmanheight 500pxisie 10 varslider6bfc33 swiperpaginationbulletsaremoveclickcontentnextsliderbuttonclickfunction e iecontentswippervar appendforswiperbuttonprevspacebetween 0slidesperview 1looppagination0slidesperview 1loop truepaginationbulletrendercitynews var

Longtail Keyword Density for Hurriyet.com.tr

KeywordsOccurences
citysliderhtml citysliderhtml citysliderhtml13
e ie-content-swipper aremovevar6
ie-content-swipper aremovevar trigerlink6
if datacountrycode tr5
index classname return4
function index classname4
classname return index4
return index 14
ie-next-buttonvar prevsliderbutton ie-prev-buttonvar3
prevsliderbutton ie-prev-buttonvar swiperpageination3
blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay blockfunction3
blockprevsliderbuttoncssdisplay blockfunction clickcontent3
swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay3
swiper-pagination-bullets swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay3
var nextsliderbutton ie-next-buttonvar3
falseif isie isie3
parseintmynavsplitmsie1 falseif isie3
-1 parseintmynavsplitmsie1 falseif3
isie isie 103
isie 10 var3
swiper-pagination-bullets swiper-pagination-bullet-activeeachfunction e3
10 var nextsliderbutton3
nextsliderbutton ie-next-buttonvar prevsliderbutton3
var appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction3
undefined cityid cityid3
cityid undefined cityid3
if cityid undefined3
cityid cityid 03
cityid 0 cityid3
bavurular ne zaman3
personel alm bavurular3
swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e ie-content-swipper3
swiper-pagination-bullets swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e3
appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e3
mynavindexofmsie -1 parseintmynavsplitmsie13
e var appendfor3
thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e ie-content-swipper3
e ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction3
aremoveclickcontentnextsliderbuttonclickfunction e ie-content-swipper3
ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction e3
swiper-pagination-bullet-activeeachfunction e var3
isie var mynav3
ve objeye atanrajaxurl3
cekilir ve objeye3
haber cekilir ve3
objeye atanrajaxurl httpgeolochurriyetcomtrapicountrytype3
atanrajaxurl httpgeolochurriyetcomtrapicountrytype getsuccess3
getsuccess functiondata if3
httpgeolochurriyetcomtrapicountrytype getsuccess functiondata3
ile haber cekilir3
istei ile haber3
position relative z-index3
500px position relative3
height 500px position3
function data status3
geolocusercityid undefined geolocusercityid3
citynews var iscontentcity3
bscontrol citynews var3
functiondata if datacountrycode3
datacountrycode tr dataregion3
swiper ie10documentreadyfunction function3
1 swiper ie10documentreadyfunction3
index 1 swiper3
ie10documentreadyfunction function isie3
function isie var3
mynav navigatoruseragenttolowercasereturn mynavindexofmsie3
var mynav navigatoruseragenttolowercasereturn3
truepaginationbulletrender function index3
1loop truepaginationbulletrender function3
dataregion iscontentcity var3
tr dataregion iscontentcity3
iscontentcity var citysliderhtml3
var citysliderhtml citysliderhtml3
0slidesperview 1loop truepaginationbulletrender3
swiper-button-prevspacebetween 0slidesperview 1loop3
navigatoruseragenttolowercasereturn mynavindexofmsie -13
citysliderhtml citysliderhtml16
ne zaman11
e ie-content-swipper9
data status7
aremovevar trigerlink6
datacountrycode tr6
ie-content-swipper aremovevar6
belli oldu5
if datacountrycode5
index classname4
personel alm4
function index4
slider-110645 swiper-pagination-bullets4
swiper-container pagination4
return index4
classname return4
index 14
slider-dc7fb5 swiper-pagination-bullets4
slider-6bfc33 swiper-pagination-bullets4
bavurular ne4
citynews var4
blockprevsliderbuttoncssdisplay blockfunction3
blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay3
blockfunction clickcontent3
swiper-pagination-bullets swiper-pagination-bullet-activeeachfunction3
isie 103
swiper-pagination-bullet-activeeachfunction e3
10 var3
swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay3
prevsliderbutton ie-prev-buttonvar3
nextsliderbutton ie-next-buttonvar3
ie-prev-buttonvar swiperpageination3
e var3
swiper-pagination-bullets swiper-pagination-bulletie-content-swippercssdisplay3
var nextsliderbutton3
ie-next-buttonvar prevsliderbutton3
var appendfor3
cityid undefined3
if cityid3
swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e3
undefined cityid3
cityid cityid3
0 cityid3
cityid 03
swiper-pagination-bullets swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction3
isie isie3
thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e3
appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction3
t252rkiye ka231nc3
ne kadar3
aremoveclickcontentnextsliderbuttonclickfunction e3
ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction3
alm bavurular3
var mynav3
cekilir ve3
haber cekilir3
ile haber3
istei ile3
ve objeye3
objeye atanrajaxurl3
getsuccess functiondata3
httpgeolochurriyetcomtrapicountrytype getsuccess3
atanrajaxurl httpgeolochurriyetcomtrapicountrytype3
var iscontentcity3
bscontrol citynews3
relative z-index3
position relative3
500px position3
height 500px3
function data3
geoloccountryid tr3
newshtml newshtml3
undefined geolocusercityid3
geolocusercityid undefined3
functiondata if3
tr dataregion3
isie var3
function isie3
ie10documentreadyfunction function3
swiper ie10documentreadyfunction3
mynav navigatoruseragenttolowercasereturn3
navigatoruseragenttolowercasereturn mynavindexofmsie3
parseintmynavsplitmsie1 falseif3
-1 parseintmynavsplitmsie13
mynavindexofmsie -13
1 swiper3
truepaginationbulletrender function3
var citysliderhtml3
iscontentcity var3
dataregion iscontentcity3
swiper-container swiper-wrapper3
functionerr consolelogerrvar3
1loop truepaginationbulletrender3
0slidesperview 1loop3
swiper-button-prevspacebetween 0slidesperview3
falseif isie3
var36
citysliderhtml20
function18
ne16
e16
cityid14
ve12
swiper-pagination-bullets12
if11
zaman11
swiper-container10
geolocusercityid10
tr10
010
ie-content-swipper9
isie9
slider-6bfc338
slider-1106458
bir8
citynews8
iscontentcity8
slider-dc7fb58
i231in8
index8
status7
data7
17
undefined7
bavurular7
datacountrycode6
yeni6
aremovevar6
trigerlink6
son6
bu6
b246l252m6
bscontrol6
lan6
new6
geoloccountryid6
t252rkiye5
height5
oldu5
belli5
25
falseif5
return5
o5
34
pagination4
classname4
windownamespaceq4
personel4
44
te4
newshtml4
haber4
ile4
g252n4
burs4
alm4
cname4
olay3
231alma3
aremoveclickcontentnextsliderbuttonclickfunction3
swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction3
city-list-content3
ka2313
k246t2523
ka231nc3
kayt3
yine3
kadar3
bakn3
fragman3
yaz3
daha3
53
merak3
nasl3
mynav3
swiper-wrapper3
dataregion3
functiondata3
getsuccess3
functionerr3
consolelogerrvar3
swiper-button-prevspacebetween3
swiper-button-nextprevbutton3
swiper-paginationnextbutton3
httpgeolochurriyetcomtrapicountrytype3
atanrajaxurl3
position3
500px3
iframe3
stanbul3
relative3
z-index3
objeye3
cekilir3
istei3
0slidesperview3
1loop3
blocknextsliderbuttoncssdisplay3
swiper-pagination-bulletie-content-swippercssdisplay3
swiperpageination3
ie-prev-buttonvar3
blockprevsliderbuttoncssdisplay3
blockfunction3
appendfor3
swiper-pagination-bullet-activeeachfunction3
clickcontent3
prevsliderbutton3
ie-next-buttonvar3
ie10documentreadyfunction3
swiper3
truepaginationbulletrender3
navigatoruseragenttolowercasereturn3
mynavindexofmsie3
nextsliderbutton3
parseintmynavsplitmsie13
63
thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction3

What are the nameservers for hurriyet.com.tr?

Hurriyet.com.tr Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown