Hurriyet.com.tr Website Analysis Summary
High trust score |
Hürriyet - Haber, Son Dakika Haberler, Güncel Gazete Haberleri
| Rank | 640 |
| Rating | B |
| Trust Score | High trust score |
| Estimated worth | $25,245,000 |
| Estimated daily income | $23,375 |
| Estimated monthly income | $710,990 |
| Backlinks | 0 |
Hurriyet.com.tr has a High trust score, and a Statvoo Rank of B.
Hurriyet.com.tr is hosted by DOGAN TV DIGITAL PLATFORM ISLETMECILIGI A.S. in Istanbul, Istanbul, Turkey, 34214.
Hurriyet.com.tr has an IP Address of 83.66.162.3 and a hostname of 83.66.162.3.
The domain hurriyet.com.tr was registered 201 decades 9 years 4 months ago by , it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.
It is the world's 640 most popular site among over 300 million websites.
Hurriyet.com.tr has a total of 0 backlinks.
Hurriyet.com.tr gets approximately 2,921,875 unique visitors a day and 23,375,000 pageviews per day.
Hurriyet.com.tr has an estimated worth of $25,245,000.
An average daily income of approximately $23,375, which is wroughly $710,990 per month.
Who hosts Hurriyet.com.tr?
Hurriyet.com.tr Web Server Information
| Hosted IP Address: | 83.66.162.3 |
| Hosted Hostname: | 83.66.162.3 |
| Service Provider: | DOGAN TV DIGITAL PLATFORM ISLETMECILIGI A.S. |
| Hosted Country: |  TR |
| Location Latitude: | 41.0438 |
| Location Longitude: | 28.8262 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Hurriyet.com.tr
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | private |
| Content-Type: | text/html |
| Content-Encoding: | gzip |
| Vary: | Accept-Encoding |
| Server: | Microsoft-IIS/7.5 |
| X-Powered-By: | ASP.NET |
| Date: | Fri, 22 May 2015 13:35:56 GMT |
| Content-Length: | 33451 |
Need to find out who hosts Hurriyet.com.tr?
Hurriyet.com.tr Free SEO Report
Website Inpage Analysis for Hurriyet.com.tr
| H1 Headings: | 1 | SON DAKÄ°KA HABERLER | |
| H2 Headings: | 1 | Günlük Burç Yorumları | |
| H3 Headings: | 0 | ||
| H4 Headings: | 1 | Tümü | |
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 3 | ||
| Total Images: | 260 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Hurriyet.com.tr
iecontentswipper aremoveclickcontentnextsliderbuttonclickfunctionif cityid undefinednasliscontentcitycitysliderhtml citysliderhtmlile haber cekilirappendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction eindex classnameieprevbuttonvarvar iscontentcityatanrajaxurl httpgeolochurriyetcomtrapicountrytypehaber cekilirisiesliderdc7fb5yaztre iecontentswipper aremovevarbavurulargetsuccesska2311loop truepaginationbulletrender functionalm bavurulargetsuccess functiondatanewshtmldatatruepaginationbulletrender function indextr dataregion iscontentcityyeniswiperpaginationbulletactiveeachfunctionclassname return indexile haber6laniscontentcity var citysliderhtmlswipercontainerfunction isievar mynav navigatoruseragenttolowercasereturne iecontentswipperbaknmerak500px position relativeswiperpaginationbullets swiperpaginationbulletiecontentswippercssdisplayvar appendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctiontr dataregionfunctionerrblocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplayslider110645 swiperpaginationbulletsindex classname returncekilir ve objeyeappendfor thishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctionindex 1function indexswiperpaginationbullets swiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplayiframeswiperpaginationbullets swiperpaginationbulletactiveeachfunction eblocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay blockfunctionblocknextsliderbuttoncssdisplayconsolelogerrvarhabercekilir vehttpgeolochurriyetcomtrapicountrytypecitynewszindexvar mynavslider6bfc33nextsliderbutton ienextbuttonvarfunctiondatathishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunctionolayne kadarbelliie10documentreadyfunction functiongeoloccountryiddata statusaremoveclickcontentnextsliderbuttonclickfunction eswiperpaginationbullets swiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction ebavurular ne zamane var appendforstatusthishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction e iecontentswippercnamereturn10 varnextsliderbutton ienextbuttonvar prevsliderbutton10 var nextsliderbuttonswiper ie10documentreadyfunctiontehaber cekilir veindex 1 swiperswiperbuttonprevspacebetweenolduif cityidreturn index 1yineblockfunction clickcontenthttpgeolochurriyetcomtrapicountrytype getsuccessgeolocusercityid3cityid 0 cityidfunctiondata if datacountrycodeundefined cityid cityidg252nfalseifgetsuccess functiondata iftruepaginationbulletrender function1 swiper ie10documentreadyfunctionfunctionerr consolelogerrvarswiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplayclassname returnbelli oldubscontrol citynews varvar citysliderhtml citysliderhtmlkayt1 swipermynavindexofmsiefunctionheight 500px positionswiperpaginationbulletiecontentswippercssdisplay0 cityid5undefinedfalseif isiecityid cityid 041 parseintmynavsplitmsie1blockfunctionne zamanfalseif isie isieprevsliderbutton ieprevbuttonvartruepaginationbulletrenderkadargeolocusercityid undefinedposition relativedataregion iscontentcity0dahaift252rkiye ka231ncobjeye atanrajaxurl httpgeolochurriyetcomtrapicountrytypee vargeoloccountryid triecontentswipper aremovevarswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunctionaremovevarpersonelnavigatoruseragenttolowercasereturnif datacountrycodee iecontentswipper aremoveclickcontentnextsliderbuttonclickfunctionparseintmynavsplitmsie1 falseif isiehttpgeolochurriyetcomtrapicountrytype getsuccess functiondatave objeyeswiper ie10documentreadyfunction functionbirswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction eisie varrelativemynavindexofmsie 1odatacountrycode tr231almaclassnameswiperprevsliderbutton ieprevbuttonvar swiperpageinationswipercontainer paginationcitynews var iscontentcityie10documentreadyfunctionistei ile habergeolocusercityid undefined geolocusercityidaremoveclickcontentnextsliderbuttonclickfunctionmynavindexofmsie 1 parseintmynavsplitmsie1500pxcityid 0ka231nc0slidesperview 1loopvar nextsliderbutton ienextbuttonvardatacountrycode tr dataregionisie isienavigatoruseragenttolowercasereturn mynavindexofmsie 1atanrajaxurl httpgeolochurriyetcomtrapicountrytype getsuccessdataregion iscontentcity varswiperpaginationbulletsfunction data statuscitysliderhtmlfunctiondata ifswiperbuttonnextprevbuttonienextbuttonvar prevsliderbuttonslider110645isie var mynavfunction isie varienextbuttonvar prevsliderbutton ieprevbuttonvardatacountrycodealmpositioniecontentswipper aremovevar trigerlinkobjeyeswiperpaginationbulletactiveeachfunction eblockprevsliderbuttoncssdisplay blockfunction clickcontentparseintmynavsplitmsie1b246l252mbscontrol citynewsileisteiswiperpaginationbullets swiperpaginationbulletactiveeachfunctionblockprevsliderbuttoncssdisplay blockfunctionnewshtml newshtmlmynavreturn indexdataregionbucityidiecontentswipper aremoveclickcontentnextsliderbuttonclickfunction evarwindownamespaceqistei ilesliderdc7fb5 swiperpaginationbulletsfunction index classnameswiperpaginationbulletiecontentswippercssdisplay blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplaypersonel alm bavurularappendforesonve objeye atanrajaxurlcitysliderhtml citysliderhtml citysliderhtmlienextbuttonvarblockprevsliderbuttoncssdisplayfunction dataswiperpageinationmynav navigatoruseragenttolowercasereturn mynavindexofmsie0slidesperview1loopbavurular nerelative zindexk246t252swiperpaginationbulletactiveeachfunction e varcityid undefined cityidzamanswiperbuttonprevspacebetween 0slidesperviewbursif datacountrycode trtrigerlink2citylistcontentswiperpaginationbullets swiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunctioncityid undefined1loop truepaginationbulletrenderi231in1position relative zindexprevsliderbuttonneswipercontainer swiperwrapperpersonel almisie isie 10atanrajaxurl1 parseintmynavsplitmsie1 falseifiecontentswippervar nextsliderbuttonieprevbuttonvar swiperpageinationnavigatoruseragenttolowercasereturn mynavindexofmsiebscontrolvenextsliderbuttonstanbulundefined cityidmynav navigatoruseragenttolowercasereturnt252rkiyeparseintmynavsplitmsie1 falseifcityid cityid500px positionisie 10aremovevar trigerlinkswiperpaginationbulletactivetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e iecontentswipperobjeye atanrajaxurlvar citysliderhtmlnewheightie10documentreadyfunction function isieswiperwrapperundefined geolocusercityidthishtmliecontentswipperappendappendforepreventdefaultswiperpageinationhoverfunction eindexiscontentcity varcekilirswiperpaginationnextbuttonclickcontentfragmanheight 500pxisie 10 varslider6bfc33 swiperpaginationbulletsaremoveclickcontentnextsliderbuttonclickfunction e iecontentswippervar appendforswiperbuttonprevspacebetween 0slidesperview 1looppagination0slidesperview 1loop truepaginationbulletrendercitynews var
Longtail Keyword Density for Hurriyet.com.tr
| Keywords | Occurences |
|---|---|
| citysliderhtml citysliderhtml citysliderhtml | 13 |
| e ie-content-swipper aremovevar | 6 |
| ie-content-swipper aremovevar trigerlink | 6 |
| if datacountrycode tr | 5 |
| index classname return | 4 |
| function index classname | 4 |
| classname return index | 4 |
| return index 1 | 4 |
| ie-next-buttonvar prevsliderbutton ie-prev-buttonvar | 3 |
| prevsliderbutton ie-prev-buttonvar swiperpageination | 3 |
| blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay blockfunction | 3 |
| blockprevsliderbuttoncssdisplay blockfunction clickcontent | 3 |
| swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay | 3 |
| swiper-pagination-bullets swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay | 3 |
| var nextsliderbutton ie-next-buttonvar | 3 |
| falseif isie isie | 3 |
| parseintmynavsplitmsie1 falseif isie | 3 |
| -1 parseintmynavsplitmsie1 falseif | 3 |
| isie isie 10 | 3 |
| isie 10 var | 3 |
| swiper-pagination-bullets swiper-pagination-bullet-activeeachfunction e | 3 |
| 10 var nextsliderbutton | 3 |
| nextsliderbutton ie-next-buttonvar prevsliderbutton | 3 |
| var appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction | 3 |
| undefined cityid cityid | 3 |
| cityid undefined cityid | 3 |
| if cityid undefined | 3 |
| cityid cityid 0 | 3 |
| cityid 0 cityid | 3 |
| bavurular ne zaman | 3 |
| personel alm bavurular | 3 |
| swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e ie-content-swipper | 3 |
| swiper-pagination-bullets swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e | 3 |
| appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e | 3 |
| mynavindexofmsie -1 parseintmynavsplitmsie1 | 3 |
| e var appendfor | 3 |
| thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e ie-content-swipper | 3 |
| e ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction | 3 |
| aremoveclickcontentnextsliderbuttonclickfunction e ie-content-swipper | 3 |
| ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction e | 3 |
| swiper-pagination-bullet-activeeachfunction e var | 3 |
| isie var mynav | 3 |
| ve objeye atanrajaxurl | 3 |
| cekilir ve objeye | 3 |
| haber cekilir ve | 3 |
| objeye atanrajaxurl httpgeolochurriyetcomtrapicountrytype | 3 |
| atanrajaxurl httpgeolochurriyetcomtrapicountrytype getsuccess | 3 |
| getsuccess functiondata if | 3 |
| httpgeolochurriyetcomtrapicountrytype getsuccess functiondata | 3 |
| ile haber cekilir | 3 |
| istei ile haber | 3 |
| position relative z-index | 3 |
| 500px position relative | 3 |
| height 500px position | 3 |
| function data status | 3 |
| geolocusercityid undefined geolocusercityid | 3 |
| citynews var iscontentcity | 3 |
| bscontrol citynews var | 3 |
| functiondata if datacountrycode | 3 |
| datacountrycode tr dataregion | 3 |
| swiper ie10documentreadyfunction function | 3 |
| 1 swiper ie10documentreadyfunction | 3 |
| index 1 swiper | 3 |
| ie10documentreadyfunction function isie | 3 |
| function isie var | 3 |
| mynav navigatoruseragenttolowercasereturn mynavindexofmsie | 3 |
| var mynav navigatoruseragenttolowercasereturn | 3 |
| truepaginationbulletrender function index | 3 |
| 1loop truepaginationbulletrender function | 3 |
| dataregion iscontentcity var | 3 |
| tr dataregion iscontentcity | 3 |
| iscontentcity var citysliderhtml | 3 |
| var citysliderhtml citysliderhtml | 3 |
| 0slidesperview 1loop truepaginationbulletrender | 3 |
| swiper-button-prevspacebetween 0slidesperview 1loop | 3 |
| navigatoruseragenttolowercasereturn mynavindexofmsie -1 | 3 |
| citysliderhtml citysliderhtml | 16 |
| ne zaman | 11 |
| e ie-content-swipper | 9 |
| data status | 7 |
| aremovevar trigerlink | 6 |
| datacountrycode tr | 6 |
| ie-content-swipper aremovevar | 6 |
| belli oldu | 5 |
| if datacountrycode | 5 |
| index classname | 4 |
| personel alm | 4 |
| function index | 4 |
| slider-110645 swiper-pagination-bullets | 4 |
| swiper-container pagination | 4 |
| return index | 4 |
| classname return | 4 |
| index 1 | 4 |
| slider-dc7fb5 swiper-pagination-bullets | 4 |
| slider-6bfc33 swiper-pagination-bullets | 4 |
| bavurular ne | 4 |
| citynews var | 4 |
| blockprevsliderbuttoncssdisplay blockfunction | 3 |
| blocknextsliderbuttoncssdisplay blockprevsliderbuttoncssdisplay | 3 |
| blockfunction clickcontent | 3 |
| swiper-pagination-bullets swiper-pagination-bullet-activeeachfunction | 3 |
| isie 10 | 3 |
| swiper-pagination-bullet-activeeachfunction e | 3 |
| 10 var | 3 |
| swiper-pagination-bulletie-content-swippercssdisplay blocknextsliderbuttoncssdisplay | 3 |
| prevsliderbutton ie-prev-buttonvar | 3 |
| nextsliderbutton ie-next-buttonvar | 3 |
| ie-prev-buttonvar swiperpageination | 3 |
| e var | 3 |
| swiper-pagination-bullets swiper-pagination-bulletie-content-swippercssdisplay | 3 |
| var nextsliderbutton | 3 |
| ie-next-buttonvar prevsliderbutton | 3 |
| var appendfor | 3 |
| cityid undefined | 3 |
| if cityid | 3 |
| swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction e | 3 |
| undefined cityid | 3 |
| cityid cityid | 3 |
| 0 cityid | 3 |
| cityid 0 | 3 |
| swiper-pagination-bullets swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction | 3 |
| isie isie | 3 |
| thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction e | 3 |
| appendfor thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction | 3 |
| t252rkiye ka231nc | 3 |
| ne kadar | 3 |
| aremoveclickcontentnextsliderbuttonclickfunction e | 3 |
| ie-content-swipper aremoveclickcontentnextsliderbuttonclickfunction | 3 |
| alm bavurular | 3 |
| var mynav | 3 |
| cekilir ve | 3 |
| haber cekilir | 3 |
| ile haber | 3 |
| istei ile | 3 |
| ve objeye | 3 |
| objeye atanrajaxurl | 3 |
| getsuccess functiondata | 3 |
| httpgeolochurriyetcomtrapicountrytype getsuccess | 3 |
| atanrajaxurl httpgeolochurriyetcomtrapicountrytype | 3 |
| var iscontentcity | 3 |
| bscontrol citynews | 3 |
| relative z-index | 3 |
| position relative | 3 |
| 500px position | 3 |
| height 500px | 3 |
| function data | 3 |
| geoloccountryid tr | 3 |
| newshtml newshtml | 3 |
| undefined geolocusercityid | 3 |
| geolocusercityid undefined | 3 |
| functiondata if | 3 |
| tr dataregion | 3 |
| isie var | 3 |
| function isie | 3 |
| ie10documentreadyfunction function | 3 |
| swiper ie10documentreadyfunction | 3 |
| mynav navigatoruseragenttolowercasereturn | 3 |
| navigatoruseragenttolowercasereturn mynavindexofmsie | 3 |
| parseintmynavsplitmsie1 falseif | 3 |
| -1 parseintmynavsplitmsie1 | 3 |
| mynavindexofmsie -1 | 3 |
| 1 swiper | 3 |
| truepaginationbulletrender function | 3 |
| var citysliderhtml | 3 |
| iscontentcity var | 3 |
| dataregion iscontentcity | 3 |
| swiper-container swiper-wrapper | 3 |
| functionerr consolelogerrvar | 3 |
| 1loop truepaginationbulletrender | 3 |
| 0slidesperview 1loop | 3 |
| swiper-button-prevspacebetween 0slidesperview | 3 |
| falseif isie | 3 |
| var | 36 |
| citysliderhtml | 20 |
| function | 18 |
| ne | 16 |
| e | 16 |
| cityid | 14 |
| ve | 12 |
| swiper-pagination-bullets | 12 |
| if | 11 |
| zaman | 11 |
| swiper-container | 10 |
| geolocusercityid | 10 |
| tr | 10 |
| 0 | 10 |
| ie-content-swipper | 9 |
| isie | 9 |
| slider-6bfc33 | 8 |
| slider-110645 | 8 |
| bir | 8 |
| citynews | 8 |
| iscontentcity | 8 |
| slider-dc7fb5 | 8 |
| i231in | 8 |
| index | 8 |
| status | 7 |
| data | 7 |
| 1 | 7 |
| undefined | 7 |
| bavurular | 7 |
| datacountrycode | 6 |
| yeni | 6 |
| aremovevar | 6 |
| trigerlink | 6 |
| son | 6 |
| bu | 6 |
| b246l252m | 6 |
| bscontrol | 6 |
| lan | 6 |
| new | 6 |
| geoloccountryid | 6 |
| t252rkiye | 5 |
| height | 5 |
| oldu | 5 |
| belli | 5 |
| 2 | 5 |
| falseif | 5 |
| return | 5 |
| o | 5 |
| 3 | 4 |
| pagination | 4 |
| classname | 4 |
| windownamespaceq | 4 |
| personel | 4 |
| 4 | 4 |
| te | 4 |
| newshtml | 4 |
| haber | 4 |
| ile | 4 |
| g252n | 4 |
| burs | 4 |
| alm | 4 |
| cname | 4 |
| olay | 3 |
| 231alma | 3 |
| aremoveclickcontentnextsliderbuttonclickfunction | 3 |
| swiper-pagination-bullet-activetrigerlinknextfindatriggermouseenterclickcontentepreventdefaultprevsliderbuttonclickfunction | 3 |
| city-list-content | 3 |
| ka231 | 3 |
| k246t252 | 3 |
| ka231nc | 3 |
| kayt | 3 |
| yine | 3 |
| kadar | 3 |
| bakn | 3 |
| fragman | 3 |
| yaz | 3 |
| daha | 3 |
| 5 | 3 |
| merak | 3 |
| nasl | 3 |
| mynav | 3 |
| swiper-wrapper | 3 |
| dataregion | 3 |
| functiondata | 3 |
| getsuccess | 3 |
| functionerr | 3 |
| consolelogerrvar | 3 |
| swiper-button-prevspacebetween | 3 |
| swiper-button-nextprevbutton | 3 |
| swiper-paginationnextbutton | 3 |
| httpgeolochurriyetcomtrapicountrytype | 3 |
| atanrajaxurl | 3 |
| position | 3 |
| 500px | 3 |
| iframe | 3 |
| stanbul | 3 |
| relative | 3 |
| z-index | 3 |
| objeye | 3 |
| cekilir | 3 |
| istei | 3 |
| 0slidesperview | 3 |
| 1loop | 3 |
| blocknextsliderbuttoncssdisplay | 3 |
| swiper-pagination-bulletie-content-swippercssdisplay | 3 |
| swiperpageination | 3 |
| ie-prev-buttonvar | 3 |
| blockprevsliderbuttoncssdisplay | 3 |
| blockfunction | 3 |
| appendfor | 3 |
| swiper-pagination-bullet-activeeachfunction | 3 |
| clickcontent | 3 |
| prevsliderbutton | 3 |
| ie-next-buttonvar | 3 |
| ie10documentreadyfunction | 3 |
| swiper | 3 |
| truepaginationbulletrender | 3 |
| navigatoruseragenttolowercasereturn | 3 |
| mynavindexofmsie | 3 |
| nextsliderbutton | 3 |
| parseintmynavsplitmsie1 | 3 |
| 6 | 3 |
| thishtmlie-content-swipperappendappendforepreventdefaultswiperpageinationhoverfunction | 3 |
What are the nameservers for hurriyet.com.tr?
Hurriyet.com.tr Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| Unknown | Unknown | Unknown | Unknown |
