Hypodomus.nl Favicon Hypodomus.nl

Hypodomus.nl Website Thumbnail
Checking...
Home
Low trust score
 | 
Add a review Change category Claim this site

Domain summary

Domain label
hypodomus
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is hypodomus.nl ranked relative to other sites:

Percentage of visits to hypodomus.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Hypodomus.nl registered?
A: Hypodomus.nl was registered 3 weeks, 2 days, 8 hours, 4 minutes, 32 seconds ago on Thursday, September 3, 2020.
Q: When was the WHOIS for Hypodomus.nl last updated?
A: The WHOIS entry was last updated 3 weeks, 2 days, 8 hours, 4 minutes, 32 seconds ago on Thursday, September 3, 2020.
Q: What are Hypodomus.nl's nameservers?
A: DNS for Hypodomus.nl is provided by the following nameservers:
  • ns1.realworks.nl
  • ns2.realworks.nl
Q: Who is the registrar for the Hypodomus.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Hypodomus.nl?
A: Hypodomus.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Hypodomus.nl each day?
A: Hypodomus.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Hypodomus.nl resolve to?
A: Hypodomus.nl resolves to the IPv4 address 37.48.108.22.
Q: In what country are Hypodomus.nl servers located in?
A: Hypodomus.nl has servers located in the Netherlands.
Q: What webserver software does Hypodomus.nl use?
A: Hypodomus.nl is powered by Apache/2 webserver.
Q: Who hosts Hypodomus.nl?
A: Hypodomus.nl is hosted by LeaseWeb Netherlands B.V. in Netherlands.
Q: How much is Hypodomus.nl worth?
A: Hypodomus.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hypodomus.nl?

Hypodomus.nl Hosting Provider Information

Hosted IP Address:37.48.108.22
Hosted Hostname:srv9.topplatform.nl
Service Provider:LeaseWeb Netherlands B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:Apache/2

Is "LeaseWeb Netherlands B.V." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Hypodomus.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 03 Sep 2020 17:10:11 GMT
Server: Apache/2
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Fri, 25 May 2018 19:53:15 GMT
ETag: "6f19-56d0d1e5f21a8-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 6788
Content-Type: text/html

Hypodomus.nl Domain Nameserver Information

HostIP AddressCountry
ns1.realworks.nl 194.109.157.62Netherlands Netherlands
ns2.realworks.nl 87.255.56.129Netherlands Netherlands


Need to find out who hosts Hypodomus.nl?


WhoIs information for Hypodomus.nl

 Domain name: hypodomus.nl
Status: active

Registrar:
Realworks B.V.
Jacob Bontiusplaats 9
1018LL AMSTERDAM
Netherlands

Abuse Contact:

Creation Date: 2007-01-08

Updated Date: 2015-08-20

DNSSEC: no

Domain nameservers:
ns1.realworks.nl
ns2.realworks.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Hypodomus.nl Free SEO Report

Website Inpage Analysis for Hypodomus.nl

H1 Headings

2 :
  1. Kies hier een Hypodomus vestiging bij jou in de buurt
  2. Volledig transparant hypotheekadvies

H2 Headings

9 :
  1. Makelaar Amsterdam
  2. Makelaar Bergen op Zoom
  3. Makelaar Breda
  4. Makelaar Maastricht
  5. Makelaar Eindhoven
  6. Makelaar Leiden
  7. Hypodomus heet onze collega’s van de nieuwe vestiging in Amsterdam van harte welkom!
  8. Bekijk hun woningaanbod in Amsterdam
  9. Bij Hypodomus krijg je altijd de laagste hypotheekrente!

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-72532570-1

Links - Internal

20:
  1. No text
    http://hypodomus.nl/index.html
  2. Makelaar
    http://hypodomus.nl/makelaar.html
  3. Huis verkopen
    http://hypodomus.nl/huis-verkopen.html
  4. Huis taxeren
    http://hypodomus.nl/huis-taxeren.html
  5. Huis verhuren
    http://hypodomus.nl/huis-verhuren.html
  6. Huis kopen
    http://hypodomus.nl/huis-kopen.html
  7. Aankoop makelaar
    http://hypodomus.nl/aankoop-makelaar.html
  8. Alles in 1 woonadvies
    http://hypodomus.nl/alles-in-1-woonadvies.html
  9. Aankooptips
    http://hypodomus.nl/aankooptips.html
  10. Expats
    http://hypodomus.nl/expats.html
  11. hypotheek
    http://hypodomus.nl/hypotheek.html
  12. Hypotheekadvies
    http://hypodomus.nl/hypotheekadvies.html
  13. ben je starter?
    http://hypodomus.nl/ben-je-starter.html
  14. Contact opnemen
    http://hypodomus.nl/contact-opnemen.html
  15. woningaanbod
    http://hypodomus.nl/woning-aanbod.html
  16. overhypodomus
    http://hypodomus.nl/over-hypodomus.html
  17. Contact
    http://hypodomus.nl/contact.html
  18. Maak een afspraak
    http://hypodomus.nl/contact.html
  19. Meer weten?
    http://hypodomus.nl/hypotheek.html
  20. Disclaimer
    http://hypodomus.nl/disclaimer.html

Links - Internal (nofollow)

0:

Links - Outbound

14:
  1. Bergen op zoom
    http://www.hypodomus-bergenopzoom.nl/aanbod/woningaanbod/
  2. Eindhoven
    http://www.hypodomus-eindhoven.nl/aanbod/woningaanbod/
  3. Breda
    http://www.hypodomus-breda.nl/aanbod/woningaanbod/
  4. Leiden
    http://www.hypodomusrickrijnbeek.nl/aanbod/woningaanbod/
  5. Maastricht
    http://www.hypodomus-maastricht.nl/aanbod/woningaanbod/
  6. Amsterdam
    http://www.hypodomus-amsterdam.nl/aanbod/woningaanbod/
  7. Makelaar AmsterdamBezoek de site
    http://www.hypodomus-amsterdam.nl
  8. Makelaar Bergen op ZoomBezoek de site
    http://www.hypodomus-bergenopzoom.nl
  9. Makelaar BredaBezoek de site
    http://www.hypodomus-breda.nl
  10. Makelaar MaastrichtBezoek de site
    http://www.hypodomus-maastricht.nl/
  11. Makelaar EindhovenBezoek de site
    http://www.hypodomus-eindhoven.nl
  12. Makelaar LeidenBezoek de site
    http://www.hypodomusrickrijnbeek.nl/
  13. Hypodomus heet onze collega’s van de nieuwe vestiging in Amsterdam van harte welkom!
    http://www.hypodomus-amsterdam.nl
  14. Bekijk hun woningaanbod in Amsterdam
    http://www.hypodomus-amsterdam.nl/aanbod/woningaanbod/

Links - Outbound (nofollow)

0:

Keyword Cloud for Hypodomus.nl

huissite makelaarvanhypotheekadviesamsterdamsitemakelaarhypodomuseenje

Longtail Keyword Density for Hypodomus.nl

KeywordsOccurences
site makelaar5
makelaar8
hypodomus7
je6
site6
huis4
hypotheekadvies3
amsterdam3
een3
van3

Hypodomus.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Hypodomus.nl is a scam?

Websites with Similar Names

Hypodermatically.xyz
hypodermatically.xyz
Hypodirectlender.com
401 Unauthorized
Hypodrom.cz
403 Forbidden

Recently Updated Websites

Internorm.com 3 seconds ago.Embracethe.com 4 seconds ago.Nostalgicbebe.com 4 seconds ago.Lanekrejcik.com 4 seconds ago.Miniprofiler.com 4 seconds ago.Lepetitcoeur.org 5 seconds ago.Mummified.net 5 seconds ago.Strategic-video.com 6 seconds ago.Petspace-product.com 7 seconds ago.Tumusicalatina.com 7 seconds ago.Pkrsvayriengfc.com 8 seconds ago.Marssociety.pl 8 seconds ago.Donnahunglaw.com 9 seconds ago.Plentra.com 9 seconds ago.Antoniodasilvafilms.com 9 seconds ago.Tamhigh.com 10 seconds ago.Seattlemoldremoval.com 10 seconds ago.Wwwallsaints.com 10 seconds ago.Mambo.com.au 10 seconds ago.Liveyoursoulscape.com 11 seconds ago.Blueridgeavandlighting.com 12 seconds ago.Downair.com 13 seconds ago.Positivesupportservices.com 13 seconds ago.Lukavec.com 13 seconds ago.Keshavareddy.com 14 seconds ago.Familyforever.se 14 seconds ago.Baovethanglong.vn 15 seconds ago.Cantajuego.com 15 seconds ago.Pennstateexpress.com 15 seconds ago.Talesoftheunexpectedtvseries.co.uk 16 seconds ago.