Hyundai Import Gesellschaft m.b.H.

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 792,452
Estimated Worth: $1,440

Die breiteste Antriebsvielfalt bei E-Mobilität. Click2Buy Modelle online bestellen und direkt nach Hause geliefert. Auto abonnieren und teilen. Das ist Hyundai. Mehr erfahren!



Domain summary

Last updated
2020-10-25
Domain label
hyundai
Domain extension
at
Global Traffic Rank
792,452
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Frequently Asked Questions (FAQ)

Q: When was Hyundai.at registered?
A: Hyundai.at was registered 10 months, 3 weeks, 4 days, 16 hours, 17 minutes, 27 seconds ago on Sunday, October 25, 2020.
Q: When was the WHOIS for Hyundai.at last updated?
A: The WHOIS entry was last updated 10 months, 3 weeks, 4 days, 16 hours, 17 minutes, 27 seconds ago on Sunday, October 25, 2020.
Q: What are Hyundai.at's nameservers?
A: DNS for Hyundai.at is provided by the following nameservers:
  • dns2.a1.net
  • dns1.a1.net
  • dns3.a1.net
Q: Who is the registrar for the Hyundai.at domain?
A: The domain has been registered at NIC-AT.
Q: What is the traffic rank for Hyundai.at?
A: Hyundai.at ranks 792,452 globally on Alexa. Hyundai.at has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Hyundai.at each day?
A: Hyundai.at receives approximately 897 visitors and 1,794 page impressions per day.
Q: What IP address does Hyundai.at resolve to?
A: Hyundai.at resolves to the IPv4 address 213.33.80.104.
Q: In what country are Hyundai.at servers located in?
A: Hyundai.at has servers located in the Austria.
Q: What webserver software does Hyundai.at use?
A: Hyundai.at is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Hyundai.at?
A: Hyundai.at is hosted by A1 Telekom Austria AG in Austria.
Q: How much is Hyundai.at worth?
A: Hyundai.at has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Hyundai.at Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Hyundai.at Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Hyundai.at

H1 Headings

5 :
  1. Click Auto online kaufen.
  2. Der neue Hyundai i20
  3. Doppelter E-Bonus.
  4. Der neue Tucson.
  5. Share

H2 Headings

10 :
  1. Gratis Hauszustellung inklusive.
  2. Schaut gut aus und schaut auf Sie.
  3. Hohe Reichweiten. Prompt verfügbar.
  4. Visionäre Technik in kraftvollem Design.
  5. Ihr Schnelleinstieg
  6. Meinen perfekten Hyundai finden.
  7. Mein Hyundai Wunschmodell finanzieren.
  8. Meinen perfekten Hyundai finden.
  9. Mein Hyundai Wunschmodell finanzieren.
  10. News & Pressestimmen

H3 Headings

41 :
  1. Warum E-Mobilität?
  2. Best of E-Mobilität
  3. E-Mobilität ausprobieren
  4. E-Modelle online kaufen
  5. E-Mobilität Aktionen
  6. Laden & Reichweite
  7. E-Vorteile für Unternehmer
  8. Mobilitätsdienstleistungen
  9. Gut zu wissen
  10. Garantie
  11. Servicetermin vereinbaren
  12. Service Inspektion
  13. Finanzierung
  14. Meine Reifen
  15. Zubehör
  16. Ersatzteile
  17. Merchandising
  18. Design
  19. Technologie
  20. Sicherheit
  21. Über uns
  22. Aktionen
  23. News
  24. Presse
  25. Sponsoring
  26. Händler werden
  27. Willkommen
  28. B2B Angebote
  29. B2B E-Vorteile
  30. Fleet & Taxi Center
  31. Ich bin...
  32. Ich bin... Hyundai Interessent und möchte ...
  33. Ich bin... Hyundai Kunde und möchte ...
  34. Ich bin... Unternehmer und möchte ...
  35. In 5 Klicks meinen perfekten Hyundai finden und finanzieren.
  36. Aktuelles bei Hyundai.
  37. Hyundai (er-)fahren.
  38. Laufen auch Sie weiter als die anderen?
  39. #laufenmithyundai
  40. Für Hyundai Newsletter anmelden.
  41. Der ultimative Kurvenflitzer: Der neue Hyundai i20 N.

H4 Headings

21 :
  1. Der neue i30. Das Auto für jede Gelegenheit.
  2. Händler-Online-Angebote
  3. Eine neue Zeit bricht an. Eine gute Zeit.
  4. Hyundai Abo
  5. Personenschutzpakete
  6. Meine Reifen. Meine Vorteile
  7. Das richtige Auto finden.
  8. Hyundai Probe fahren.
  9. Hyundai Aktionen entdecken.
  10. Hyundai Kona Elektro Level 5 64 kWh im Test
  11. Mit dem E-Kona verschwindet das Reichweitenproblem
  12. Hyundai i10 Level 4 1.2 Praxistest – Der Kleinste ganz groß!
  13. Hyundai Kona Hybrid: Der Strom in Kurzarbeit
  14. Achtung, Lackel von links!
  15. Der Hyundai i10: Innovativ, aber nicht naiv
  16. Hyundai i10 1,2 MT Level 4 - Testbericht
  17. Hyundai IONIQ Hybrid Level 6 – Testbericht
  18. Hyundai: Die neuen Modelle
  19. Kona Hybrid: Ein Typ für alle Antriebe
  20. Der neue Hyundai i20: Emotionales Design trifft auf fortschrittliche Technik
  21. Cowboy oder doch lieber Indianer? Der Santa Fe ist der Größte von Hyundais Outdoor-Kriegern. Wild sind aber nur seine 185 PS.

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

103 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

96:

Links - Internal (nofollow)

0:

Links - Outbound

39:

Links - Outbound (nofollow)

0:

Keyword Cloud for Hyundai.at

schnellmein hyundai wunschmodelltopelsehybrid ioniq pluginifbin hyundaiaktionenhyundai i10technikanfrageemobilit228tkona elektro konameinerdateneinenhybrid ioniqihrerservicestrae 14 1230elektro kona hybridneuekona hybridzum zweckeonline vomdasinformationenhyundai wunschmodellperfektenwerdenanmeldenlevel 4zum zwecke dervar i 0einoderdersanta fehybriddocumentqueryselectorallheaderslidermeineeineder neuewelchesautoprodukteioniq hybrid ioniqi3014 1230 wienioniqauchnzureifen14 1230zweckenewsich binmiterfllungimport gesellschaft mbhgew252nschte4angebotestraefunctionmeine reifengesellschaft mbhmodellewunschmodell finanzierenfemchteder neue i30meinen perfektenmeinonlinef252rvonzwecke derunternehmerneue i30alszurimportdieioniq pluginmanhyundai partnerkaufenmirganzsiezurcknewsletterschautentdeckenhyundainexoihnenaminformationen datenschutzfinanzierensantawunschmodell2ioniq elektroplugin ioniqistder neue hyundaiprodukte und dienstleistungenprobefahrtleveldesignaber1230 wienhyundai import gesellschaftfastbackneue hyundaihyundai importpartnervon mirampdenplugin ioniq elektroprofitierenkontaktwienrechtlichekaich bin hyundaiprobeaufmein hyundaizumtucsonprobe fahrenkombimbhichmeine gew252nschtepartner findenbinperfekten hyundai findeni20ioniq hybridkennenlernenrechtliche informationenkonfiguratorfahrenfr13ihrenneue hyundai i20berimport gesellschaftrechtliche informationen datenschutzkonakona elektro0elektro konameinen perfekten hyundaisichsdienstleistungeni30 fastbackhyundai wunschmodell finanzierentop angeboteder hyundaimehrjetztdatenschutzvarvommeinenperfekten hyundaifindeni10ioniq plugin ioniqdemneuenhyundai i20elektrozur erfllungeinfachstrae 14hyundai findengesellschaftplugin

Longtail Keyword Density for Hyundai.at

KeywordsOccurences
der neue i307
hyundai import gesellschaft5
import gesellschaft mbh5
perfekten hyundai finden4
meinen perfekten hyundai4
var i 04
zum zwecke der4
rechtliche informationen datenschutz4
elektro kona hybrid3
kona elektro kona3
der neue hyundai3
ioniq hybrid ioniq3
plug-in ioniq elektro3
ich bin hyundai3
ioniq plug-in ioniq3
hybrid ioniq plug-in3
mein hyundai wunschmodell3
hyundai wunschmodell finanzieren3
strae 14 12303
14 1230 wien3
produkte und dienstleistungen3
neue hyundai i203
der neue15
neue i307
kona hybrid5
gesellschaft mbh5
import gesellschaft5
hyundai import5
hyundai i105
ich bin5
santa fe4
partner finden4
informationen datenschutz4
rechtliche informationen4
meinen perfekten4
perfekten hyundai4
kona elektro4
elektro kona4
hyundai finden4
zum zwecke4
zwecke der4
ioniq hybrid4
i30 fastback4
von mir4
probe fahren4
der hyundai3
hyundai partner3
strae 143
14 12303
meine gew252nschte3
1230 wien3
level 43
zur erfllung3
neue hyundai3
wunschmodell finanzieren3
hyundai wunschmodell3
mein hyundai3
bin hyundai3
hyundai i203
meine reifen3
ioniq elektro3
plug-in ioniq3
ioniq plug-in3
hybrid ioniq3
top angebote3
online vom3
hyundai56
der33
neue18
var17
sie13
vom13
die12
finden12
von12
i3012
kona11
ioniq11
meine10
zu9
hybrid9
i209
amp8
mit8
zur8
function7
n7
oder7
elektro7
fr7
das7
auch7
e-mobilit228t7
online7
ich7
ihren7
i107
auf6
auto6
informationen6
jetzt6
partner6
06
if5
bin5
einen5
den5
mbh5
gesellschaft5
als5
import5
angebote5
zwecke5
design5
ein5
level5
zum4
meinen4
fe4
meiner4
santa4
mein4
tucson4
fastback4
perfekten4
finanzieren4
rechtliche4
ber4
wien4
top4
fahren4
mir4
daten4
service4
technik4
kaufen4
documentqueryselectorallheader-slider4
probe4
aktionen4
werden4
datenschutz4
ist4
dem4
ganz3
aber3
dienstleistungen3
sich3
produkte3
anmelden3
13
man3
erfllung3
strae3
23
33
ka3
43
ihrer3
anfrage3
konfigurator3
else3
schnell3
kennen3
modelle3
kombi3
plug-in3
nexo3
f252r3
unternehmer3
reifen3
news3
kontakt3
newsletter3
entdecken3
schaut3
lernen3
neuen3
profitieren3
mchte3
eine3
probefahrt3
zurck3
mehr3
einfach3
wunschmodell3
welches3
am3
ihnen3
gew252nschte3
s3

Who hosts Hyundai.at?

Hyundai.at Hosting Provider Information

Hosted IP Address:213.33.80.104
Hosted Hostname:www.hyundai.at
Service Provider:A1 Telekom Austria AG
Hosted Country:AustriaAT
Location Latitude:48.2
Location Longitude:16.3667
Webserver Software:Microsoft-IIS/10.0

Is "A1 Telekom Austria AG" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
A1 Telekom Austria AG
0.0036%

HTTP Header Analysis for Hyundai.at

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Content-Type: text/html; charset=UTF-8
Location: https://www.hyundai.at/
Server: Microsoft-IIS/10.0
X-Frame-Options: sameorigin
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=31536000; preload
X-XSS-Protection: 1; mode=block
Content-Security-Policy: default-src 'self' 'unsafe-inline' 'unsafe-eval' *.autoplus.at data: hyundai.azureedge.net *.h-promise.at denzel.piwik.pro denzel.containers.piwik.pro *.ytimg.com *.adform.net *.google.com *.gstatic.com *.googleapis.com *.youtube.com *.youtu.be *.youtube-nocookie.com *.siteimprove.net *.siteimprove.com *.seadform.net *.hyundai.at siteimproveanalytics.com *.siteimproveanalytics.com *.siteimproveanalytics.io
Feature-Policy: midi 'none'
Referrer-Policy: origin-when-cross-origin
Date: Sun, 25 Oct 2020 16:31:15 GMT
Content-Length: 146

Hyundai.at Domain Nameserver Information

HostIP AddressCountry
dns2.a1.net 213.33.99.79
dns1.a1.net 80.120.17.26
dns3.a1.net 176.97.158.105


Need to find out who hosts Hyundai.at?


Domain Registration (WhoIs) information for Hyundai.at

 % Copyright (c)2020 by NIC.AT (1)
%
% Restricted rights.
%
% Except for agreed Internet operational purposes, no part of this
% information may be reproduced, stored in a retrieval system, or
% transmitted, in any form or by any means, electronic, mechanical,
% recording, or otherwise, without prior permission of NIC.AT on behalf
% of itself and/or the copyright holders. Any use of this material to
% target advertising or similar activities is explicitly forbidden and
% can be prosecuted.
%
% It is furthermore strictly forbidden to use the Whois-Database in such
% a way that jeopardizes or could jeopardize the stability of the
% technical systems of NIC.AT under any circumstances. In particular,
% this includes any misuse of the Whois-Database and any use of the
% Whois-Database which disturbs its operation.
%
% Should the user violate these points, NIC.AT reserves the right to
% deactivate the Whois-Database entirely or partly for the user.
% Moreover, the user shall be held liable for any and all damage
% arising from a violation of these points.

% Quota exceeded

Websites with Similar Names

Hyund-accent.ru
Hyundai Accent - клуб | Консультация по автомобильным неисправностям
Hyundadealerrewardcards.com
hyundadealerrewardcards.com
Hyundaebidet.com
Hyundae Bidet VN-Công Ty Thiết Bị Vệ Sinh Thông Minh Bidet Hàng Đầu – Công Ty Thiết Bị Vệ Sinh Thông Minh Hyundae Bidet
Hyundaebuffet.co.kr
::현대출장부페에 오신것을 환영합니다::
Hyundaedlmall.com
현대디엘몰 - 현대디엘몰
Hyundaehome.com
?????? : ??? ???

Recently Updated Websites

Ameriglory.com (2 seconds ago.)Nbsenterprisesltd.com (3 seconds ago.)Qazaqstan.bet (3 seconds ago.)Scapn.net (5 seconds ago.)Toutube.com.br (6 seconds ago.)Comtaboite.com (6 seconds ago.)Vebco.ru (6 seconds ago.)Femalefitnessmotivation.org (7 seconds ago.)Rechui.top (8 seconds ago.)Superiorglam.com (8 seconds ago.)Versatile.solutions (8 seconds ago.)Etcpb.org (9 seconds ago.)Inthis.life (11 seconds ago.)Idmuse.net (12 seconds ago.)Lnm.org (13 seconds ago.)Abogadosinmigracionvisausa.com (13 seconds ago.)Openyource.com (14 seconds ago.)Bushhogit.com (14 seconds ago.)Hammergaard.com (14 seconds ago.)Gabinetprotetyczny.pl (14 seconds ago.)Musicalpointers.co.uk (15 seconds ago.)Art-coin.info (15 seconds ago.)Thecoronastory.com (16 seconds ago.)Hopeofthepoormissions.org (17 seconds ago.)Nexgen-net.com (17 seconds ago.)Lesliesharpephotography.com (18 seconds ago.)Install.cash (18 seconds ago.)Paddyhak.com (18 seconds ago.)Attributions.org (19 seconds ago.)Upgradehemp.com (21 seconds ago.)

Recently Searched Keywords

caravanes (1 second ago.)fringe hair (1 second ago.)key4sublinks title (4 seconds ago.)try renew (4 seconds ago.)stylehint (5 seconds ago.)fotele biurowe dla dzieci (5 seconds ago.)good life organics (6 seconds ago.)华信学院2016届道恒校企java开发中讯公司定 (7 seconds ago.)real estate names (10 seconds ago.)1 de noviembre (10 seconds ago.)merry-ave (13 seconds ago.)coverage (14 seconds ago.)shadeg (15 seconds ago.)0 0sc media (15 seconds ago.)expressbankn mliyyat (16 seconds ago.)poltrona (16 seconds ago.)فرش کناره (17 seconds ago.)praycareshare (17 seconds ago.)0s--bgd255255255--alpha-bgd1--txtd219219219--alpha-txtd1--brwd1px--brdd333333--fntlblnormal normal (20 seconds ago.)0s--bgd255255255--alpha-bgd1--txtd219219219--alpha-txtd1--brwd1px--brdd333333--fntlblnormal (20 seconds ago.)05s ease 0s--bgd255255255--alpha-bgd1--txtd219219219--alpha-txtd1--brwd1px--brdd333333--fntlblnormal (21 seconds ago.)the hour of alex márquez (21 seconds ago.)ease 0s--bgd255255255--alpha-bgd1--txtd219219219--alpha-txtd1--brwd1px--brdd333333--fntlblnormal normal (23 seconds ago.)melewati (25 seconds ago.)5px 5px 5px--fntnormal (26 seconds ago.)deep wave closure (26 seconds ago.)day rally (27 seconds ago.)spur g (30 seconds ago.)style-jpv1t8z9navcontainerarrowstyle-jpv1t8z9navcontainerright-direction (30 seconds ago.)supraweb (31 seconds ago.)