Irresistible Cakes – Toronto | Wedding cakes, birthday cakes, custom cakes

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-26
Category: This site has not been categorized yet


Domain summary

Domain label
i-cookie
Domain extension
ca
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is i-cookie.ca ranked relative to other sites:

Percentage of visits to i-cookie.ca from a search engine:


Frequently Asked Questions (FAQ)

Q: When was I-cookie.ca registered?
A: I-cookie.ca was registered 2 months, 2 hours, 3 minutes, 11 seconds ago on Thursday, November 26, 2020.
Q: When was the WHOIS for I-cookie.ca last updated?
A: The WHOIS entry was last updated 2 months, 2 hours, 3 minutes, 11 seconds ago on Thursday, November 26, 2020.
Q: What are I-cookie.ca's nameservers?
A: DNS for I-cookie.ca is provided by the following nameservers:
  • ns57.domaincontrol.com
  • ns58.domaincontrol.com
  • ns74.domaincontrol.com
  • ns73.domaincontrol.com
Q: Who is the registrar for the I-cookie.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for I-cookie.ca?
A: I-cookie.ca has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit I-cookie.ca each day?
A: I-cookie.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does I-cookie.ca resolve to?
A: I-cookie.ca resolves to the IPv4 address 184.168.131.241.
Q: In what country are I-cookie.ca servers located in?
A: I-cookie.ca has servers located in the United States.
Q: What webserver software does I-cookie.ca use?
A: I-cookie.ca is powered by Apache/2.4.29 webserver.
Q: Who hosts I-cookie.ca?
A: I-cookie.ca is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is I-cookie.ca worth?
A: I-cookie.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

I-cookie.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

I-cookie.ca Free SEO Report

Website Related Search Terms

Website Inpage Analysis for I-cookie.ca

H1 Headings

1 :
  1. Irresistible Cakes – Toronto | Wedding cakes, birthday cakes, custom cakes

H2 Headings

2 :
  1. Featured Cakes
  2. Social Feed

H3 Headings

0 :

H4 Headings

15 :
  1. Wedding Cakes
  2. Kids Cakes
  3. Adult Cakes
  4. Religious Cakes
  5. Bridal Shower Cakes
  6. Cupcakes
  7. Sweet Sixteen Cakes
  8. Anniversary Cakes
  9. Baby Shower Cakes
  10. Graduation Cakes
  11. Corporate Cakes
  12. Cookies
  13. Cake Pops
  14. Candles
  15. Christmas Cakes

H5 Headings

1 :
  1. Delivery Partners

H6 Headings

11 :
  1. Mimmi Gumpaste Roses Fondant Wedding Cakes Toronto
  2. Camelot Pillers Wedding Cakes Toronto Irresistible Cakes
  3. Unicorn Kids Girl Birthday Cakes Toronto From Irresistible Cakes
  4. Paw Patrol kids boy Birthday Cake Buttercream
  5. Photo Full Picture Buttercream Adult Man / Boy / Woman / Girl Birthday Cake
  6. Ashly Petal Sweet Sixteen Birthday Fondant Cake From Icakes
  7. Frozen Elsa Anna Kids Girl Birthday Cake From Icakes
  8. Baby Quilt Slab Baby Shower Buttercream Cake From Irresistible Cakes
  9. Simply Fondant Wedding Cake From Irresistible Cakes
  10. Exclusive 2 Tier Monogram Topper Gold Adult Female Woman Birthday Cake Tamara From Irresistible Cakes
  11. Thomas The Train Kids Boy Birthday Cake From Irresisistible Cakes

Total IFRAMEs

1 :

Total Images

35 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-141688051-1

Links - Internal (nofollow)

0:

Links - Outbound

90:

Links - Outbound (nofollow)

0:

Keyword Cloud for I-cookie.ca

var prcvaluesplittypebaby showerhtmlvar decorprthisvalsplit tloaderremoveclasshideelseirresistiblethisvaluefunction var valuevar sizeprcsizesplit vartotalgraduationobjthisvalue varsprvalvar objsixteen cakesparsefloatdecorpr2nut freeanniversaryflavprhtmlparsefloatsizeprc4 parsefloatorgprc1100amsizechangeflavourval varurlvar valuetruecakepiccakepicval ifcakepic varadultvarcakes lactoseparsefloatttofixed2 else varttype posttorontot0bridal shower cakesvar orgprc0 flavprhtmlparsefloatsizeprc4adult cakest parsefloattorgprc0 flavprhtmlparsefloatsizeprc4 parsefloatorgprcbridalprcvaluesplit varchristmas cakes000decoratecheckedeachfunction ifthisval varifpicturepriceprcvaluesplit var cakepiccakepicvalcakespictureprice0christmasgirlifcakepic varifpictureprice pictureprice0cakes torontocake popsparsefloatpicturepricefunction varpopsorgprc0 flavprhtmlparsefloatsizeprc4cakes lactose freeifvaluepicturepricepicturepriceval ifpicturepricebirthdayparsefloatorgprc parsefloatpicturepricevar sizechangeflavourvalvar orgprcflavprcval flavprhtmlparsefloatsizeprc4flavprhtmlparsefloatsizeprc4 parsefloatorgprc parsefloatpicturepricecupcakessixteenifvalue varpicturepricepicturepriceval ifpictureprice pictureprice0all0500pmvar orgprc0 picturepricepicturepricevalnutcorporatedecorprthisvalsplit tsweet sixteenvar orgprc0fondantpicturepricepicturepricevaldecorprthisvalsplit t parsefloatt1irresistible cakesviewfalseajax typepictureprice0 flavprhtmlparsefloatsizeprc4view allajaxicakescakebaby shower cakesdecoratecheckedeachfunction ifthisvalweddingcorporate cakesbridal showerelse varlactose freefunctionorgprc0 picturepricepicturepriceval ifpicturepriceboyelse var orgprcflavprcvalparsefloatttofixed2girl birthdayanniversary cakeskidsdataajax type postvar t01100am 0500pmifresifthisvalvar t0 decoratecheckedeachfunctionparsefloatorgprcbabycakes weddingorgprc0t0 decoratecheckedeachfunction ifthisvalcakepiccakepicvalkids cakesnut free cakesdecoratecheckedeachfunctionshowerorgprc0 picturepricepicturepricevalvaluesweet sixteen cakesvar cakepiccakepicvalflavprhtmlparsefloatsizeprc4itemsvar orgprcflavprcvalelse var orgprc0orgprcflavprcvalcandlesifpictureprice pictureprice0 flavprhtmlparsefloatsizeprc4freesizechangeflavourvalvar decorprthisvalsplitparsefloatflaprc parsefloatttofixed2 elseinfoicakescaifvalue var prcvaluesplitt0 decoratecheckedeachfunctionreligious cakesfree cakesifcakepicsizechangeflavourval var sizeprcsizesplitifthisval varparsefloattparsefloatt parsefloatdecorpr2sizeprcsizesplit varparsefloatttofixed2 elseparsefloatflaprc parsefloatttofixed2wedding cakesvar prcvaluesplit varvar cakepiccakepicval ifcakepicshower cakesvar sizeprcsizesplitsweetcakes wedding cakesorgprcflavprcval flavprhtmlparsefloatsizeprc4t parsefloatt parsefloatdecorpr2decorprthisvalsplitsizeprcsizesplitcakes viewprcvaluesplitcookies0birthday cakeifcakepic var orgprc0cakes view allreligiousvar sizechangeflavourval varpictureprice0 flavprhtmlparsefloatsizeprc4 parsefloatorgprcparsefloatflaprcpostcakepiccakepicval ifcakepicgraduation cakeslactoseifthisval var decorprthisvalsplitbuttercream

Longtail Keyword Density for I-cookie.ca

KeywordsOccurences
cakes view all11
parsefloatttofixed2 else var4
parsefloatflaprc parsefloatttofixed2 else4
ajax type post4
var orgprc0 picturepricepicturepriceval3
cakepiccakepicval ifcakepic var3
ifcakepic var orgprc03
var orgprc0 flavprhtmlparsefloatsizeprc43
orgprc0 flavprhtmlparsefloatsizeprc4 parsefloatorgprc3
else var orgprc03
ifpictureprice pictureprice0 flavprhtmlparsefloatsizeprc43
orgprc0 picturepricepicturepriceval ifpictureprice3
picturepricepicturepriceval ifpictureprice pictureprice03
prcvaluesplit var cakepiccakepicval3
pictureprice0 flavprhtmlparsefloatsizeprc4 parsefloatorgprc3
flavprhtmlparsefloatsizeprc4 parsefloatorgprc parsefloatpictureprice3
else var orgprcflavprcval3
var orgprcflavprcval flavprhtmlparsefloatsizeprc43
var cakepiccakepicval ifcakepic3
cakes wedding cakes3
var prcvaluesplit var3
sizechangeflavourval var sizeprcsizesplit3
sweet sixteen cakes3
baby shower cakes3
nut free cakes3
cakes lactose free3
function var value3
var sizechangeflavourval var3
var sizeprcsizesplit var3
bridal shower cakes3
var t0 decoratecheckedeachfunction3
t0 decoratecheckedeachfunction ifthisval3
decoratecheckedeachfunction ifthisval var3
ifthisval var decorprthisvalsplit3
var decorprthisvalsplit t3
decorprthisvalsplit t parsefloatt3
t parsefloatt parsefloatdecorpr23
ifvalue var prcvaluesplit3
view all15
cakes view11
flavprhtmlparsefloatsizeprc4 parsefloatorgprc8
irresistible cakes6
wedding cakes6
else var6
var orgprc06
shower cakes6
function var5
1100am 0500pm5
free cakes5
birthday cake5
parsefloatflaprc parsefloatttofixed25
ajax type4
thisvalue var4
type post4
var prcvaluesplit4
cakes toronto4
parsefloatttofixed2 else4
baby shower4
sweet sixteen4
lactose free3
bridal shower3
prcvaluesplit var3
var cakepiccakepicval3
cakepiccakepicval ifcakepic3
ifcakepic var3
religious cakes3
orgprc0 flavprhtmlparsefloatsizeprc43
adult cakes3
kids cakes3
parsefloatt parsefloatdecorpr23
orgprc0 picturepricepicturepriceval3
picturepricepicturepriceval ifpictureprice3
ifpictureprice pictureprice03
pictureprice0 flavprhtmlparsefloatsizeprc43
parsefloatorgprc parsefloatpictureprice3
var orgprcflavprcval3
orgprcflavprcval flavprhtmlparsefloatsizeprc43
cakes wedding3
ifvalue var3
decorprthisvalsplit t3
t parsefloatt3
var obj3
girl birthday3
cakes lactose3
nut free3
cake pops3
corporate cakes3
graduation cakes3
anniversary cakes3
sixteen cakes3
var sizechangeflavourval3
christmas cakes3
sizechangeflavourval var3
var sizeprcsizesplit3
sizeprcsizesplit var3
var t03
t0 decoratecheckedeachfunction3
decoratecheckedeachfunction ifthisval3
ifthisval var3
var decorprthisvalsplit3
var value3
var67
cakes57
all16
else15
view15
cake12
true9
flavprhtmlparsefloatsizeprc49
function9
birthday8
parsefloatorgprc8
data7
wedding7
kids7
shower7
free6
irresistible6
parsefloatflaprc6
orgprc06
baby5
adult5
parsefloatttofixed25
0500pm5
1100am5
ajax4
thisvalue4
post4
url4
prcvaluesplit4
type4
items4
total4
toronto4
sweet4
sixteen4
girl3
cakepiccakepicval3
decorprthisvalsplit3
t3
parsefloatt3
parsefloatdecorpr23
sprval3
ifvalue3
cupcakes3
bridal3
ifcakepic3
decoratecheckedeachfunction3
religious3
03
picturepricepicturepriceval3
ifpictureprice3
pictureprice03
parsefloatpictureprice3
orgprcflavprcval3
infoicakesca3
ifthisval3
sizechangeflavourval3
t03
candles3
buttercream3
icakes3
fondant3
0003
13
christmas3
lactose3
html3
nut3
pops3
sizeprcsizesplit3
cookies3
corporate3
graduation3
anniversary3
ifres3
loaderremoveclasshide3
obj3
value3
boy3
false3

Who hosts I-cookie.ca?

I-cookie.ca Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Apache/2.4.29

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for I-cookie.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 26 Nov 2020 16:00:11 GMT
Server: Apache/2.4.29
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
X-Content-Type-Options: nosniff
X-Frame-Options: sameorigin
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: origin, x-requested-with, content-type
Access-Control-Allow-Methods: GET,POST,OPTIONS,DELETE,PUT
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

I-cookie.ca Domain Nameserver Information

HostIP AddressCountry
ns57.domaincontrol.com 97.74.108.29
ns58.domaincontrol.com 173.201.76.29
ns74.domaincontrol.com 173.201.74.47
ns73.domaincontrol.com 97.74.106.47


Need to find out who hosts I-cookie.ca?


Domain Registration (WhoIs) information for I-cookie.ca

 Domain Name: i-cookie.ca
Registry Domain ID: D335588-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: ca.godaddy.com
Updated Date: 2020-11-09T12:30:16Z
Creation Date: 2005-11-08T18:35:51Z
Registry Expiry Date: 2021-11-08T05:00:00Z
Registrar: Go Daddy Domains Canada, Inc
Registrar IANA ID: not applicable
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: REDACTED FOR PRIVACY
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: REDACTED FOR PRIVACY
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Billing ID: REDACTED FOR PRIVACY
Billing Name: REDACTED FOR PRIVACY
Billing Organization: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing City: REDACTED FOR PRIVACY
Billing State/Province: REDACTED FOR PRIVACY
Billing Postal Code: REDACTED FOR PRIVACY
Billing Country: REDACTED FOR PRIVACY
Billing Phone: REDACTED FOR PRIVACY
Billing Phone Ext: REDACTED FOR PRIVACY
Billing Fax: REDACTED FOR PRIVACY
Billing Fax Ext: REDACTED FOR PRIVACY
Billing Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Name Server: ns57.domaincontrol.com
Name Server: ns58.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-11-26T16:00:15Z

Websites with Similar Names

I-cook.club
I-COOK.CLUB
I-cookchannel.com
I-COOK CHANNEL
I-cookie.ca
Irresistible Cakes – Toronto | Wedding cakes, birthday cakes, custom cakes
I-cool.ca
Relief from Hot Flashes & Night Sweats | i-cool® for Menopause
I-coolhk.com
i-coolhk.com | 521: Web server is down
I-cooltea.top
清凉TEA
I-coolwindowfilm.us
SMP Window films-the ultimate choice for your window film needs.

Recently Updated Websites

Compostgaries.com (2 seconds ago.)Crwdit9.com (6 seconds ago.)Cuddlescollection.com (6 seconds ago.)Createspaceclosets.com (13 seconds ago.)Chiropractichousecallsorl.com (14 seconds ago.)Anakainisimpaniou.gr (15 seconds ago.)Colonialgardenstamford.com (16 seconds ago.)Christiane-plank.com (16 seconds ago.)Clearviewprodemo.com (17 seconds ago.)Cozynorthwoodsgetaway.com (19 seconds ago.)Cfigholdings.com (20 seconds ago.)Catchyvillas.com (21 seconds ago.)Coomputergear.com (21 seconds ago.)Ratitto.app (21 seconds ago.)Boysofnyc.com (22 seconds ago.)Confidentai.com (22 seconds ago.)Clima-habitation.com (23 seconds ago.)2013bet365.com (24 seconds ago.)Bellevuecrown.com (26 seconds ago.)Conde-salud.com (27 seconds ago.)Chromexpaints.com (27 seconds ago.)Blackbing.com (28 seconds ago.)Accesogt.com (31 seconds ago.)Croquisproject.com (32 seconds ago.)Csodona.com (33 seconds ago.)Ccrgss.com (34 seconds ago.)Selecttors.net (35 seconds ago.)Conciergecovidtesting.com (38 seconds ago.)Cintron-ics.com (38 seconds ago.)Climatecarebrokers.com (41 seconds ago.)

Recently Searched Keywords

online pharmacy 24x7 (1 second ago.)ana bayisi rn (2 seconds ago.)bio section (3 seconds ago.)bank transfer deposit (4 seconds ago.)radio ibizanapoli (6 seconds ago.)terhadap guru kita harus (7 seconds ago.)ikatids38 (9 seconds ago.)приёмная комиссия (10 seconds ago.)lecce weather today (11 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (13 seconds ago.)certifiedpdf (15 seconds ago.)margin-top 0px margin-bottom (15 seconds ago.)�1�7�1�7�0�7�1�7�ф1�7�1�7�1�7 (16 seconds ago.)программы спо 2019 (16 seconds ago.)hg9032 (17 seconds ago.)lexington kentucky (19 seconds ago.)usb bellek (20 seconds ago.)nikiski (20 seconds ago.)образовательный квест (21 seconds ago.)8am-4pm (21 seconds ago.)дополнительное профессиональное образование, профессиональное обучение (22 seconds ago.)single-product iconattrdata-placement (23 seconds ago.)учебная практика. мдк 02.02.обеспечение пассажирских перевозок и обслуживание пассажиров (23 seconds ago.)ditawarkan rumah selangorku (23 seconds ago.)cms hosting (25 seconds ago.)počastile se! marija: „karleuša je đubre!“ jk: „nisam sujetna kao ti!“ (25 seconds ago.)unboxany other coinsyetu003cspanu003eu003cpu003enu003cpu003eu003cspan (26 seconds ago.)nautiques (26 seconds ago.)işık aksesuarları (27 seconds ago.)hero7 (28 seconds ago.)