IDEA Academy - International Design & Entertainment Arts Academy

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

IDEA Academy is a new teaching centre for digital and traditional arts directed by Anthony Christov, art director at PIXAR.



Domain summary

Last updated
2020-12-18
Domain label
idea-academy
Domain extension
eu
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is idea-academy.eu ranked relative to other sites:

Percentage of visits to idea-academy.eu from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Idea-academy.eu registered?
A: Idea-academy.eu was registered 3 months, 3 weeks, 5 days, 14 hours, 24 minutes, 29 seconds ago on Friday, December 18, 2020.
Q: When was the WHOIS for Idea-academy.eu last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 5 days, 14 hours, 24 minutes, 29 seconds ago on Friday, December 18, 2020.
Q: What are Idea-academy.eu's nameservers?
A: DNS for Idea-academy.eu is provided by the following nameservers:
  • ns13.wixdns.net
  • ns12.wixdns.net
Q: Who is the registrar for the Idea-academy.eu domain?
A: The domain has been registered at EURID.
Q: What is the traffic rank for Idea-academy.eu?
A: Idea-academy.eu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Idea-academy.eu each day?
A: Idea-academy.eu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Idea-academy.eu resolve to?
A: Idea-academy.eu resolves to the IPv4 address 23.236.62.147.
Q: In what country are Idea-academy.eu servers located in?
A: Idea-academy.eu has servers located in the United States.
Q: What webserver software does Idea-academy.eu use?
A: Idea-academy.eu is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Idea-academy.eu?
A: Idea-academy.eu is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Idea-academy.eu worth?
A: Idea-academy.eu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Idea-academy.eu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Idea-academy.eu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Idea-academy.eu

H1 Headings

6 :
  1. IT / EN
  2. SEE OTHER TEACHERS
  3. Via Ludovisi 16 - 00187, Rome ITALY 
  4. ​ email: [email protected]

H2 Headings

10 :
  1. NOW AVAILABLE
  2. ONLINE!
  3. STUDY WITH THE TOP FROM THE INDUSTRY!
  4. FOR THE NEXT-GEN  CONCEPT ARTISTS
  5. ENROLLMENTS FOR THE YEAR 2021/2022 WILL OPEN IN FEBRUARY 2021 Courses are available both on-site and online!
  6. Send an email to [email protected]!
  7. UPCOMING WORKSHOPS
  8. OUR TEACHERS
  9. CONTACTS
  10. HOW TO REACH US

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

5 :
  1. Anthony Christov
  2. Ryan Lang
  3. Sam Nielson
  4. Jim Moore
  5. Nathan Fowkes

Total IFRAMEs

3 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-58824099-3

Links - Internal

34:

Links - Internal (nofollow)

0:

Links - Outbound

5:

Links - Outbound (nofollow)

0:

Keyword Cloud for Idea-academy.eu

positionabsolutetop0right0bottom0left0international designwalt disney featureblizzard onlineavenirltw0185heavy1475544sansserif04s ease10opacity1transitionopacity 04spainting colorblizzard online streamingbecomeimagebutton1hoverimageborderstylesolidbordercolorrgba249 249 249directorwiximagenielsonnormal normal 12px14emcharacter design204 204entertainment arts1px 4px rgba0design entertainment artsbackgroundcolortransparentborderstylesolidbordercolorrgba40colorfffffffontnormal255 255videogames illustrationdisney blizzardartist waltteachingdrawing painting colorcolor and designstylek4b8y881repeaterbuttondatastatedrop16px14ementertainment projects teacherifcalc100 980px8anthony christov art05s ease 0s78 78borderwidth2px borderstylesolidbordercolorrgba249 2491bordersolid rgba47 46traditional arts directeddesign entertainmentcolor6e6968160 176 10neg980px 0546 46boxshadownoneopacity1txtnew6stylek4b8y881navcontainerarrowstylek4b8y881navcontainercenterdirection3backgroundcolortransparentborderstylesolidbordercolorrgba226director at pixarmetakeywordsseopagetitleseoideargba255176 1borderstylesolidbordercolorrgba249 249traditional artsstylek4b8y881navcontainerrightdirectionsolid rgba255textalignleftcolor2f2e2eillustratormaster animationstrc1inlinecontentconceptarts academypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixaronlineriot blizzard onlineblueanimation marvelmarginleft1bordersolid rgba47pixarmarvelclientsanimation249 249 1backgroundcolorrgba255187 61normal 12px14empositionfixedeaseentertainment arts academypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloatingselectfocusborderstylesolidbordercolorrgba249255 1 stylek4b8y881navcontainerultextalignrightwiximage positionabsolutetop0right0bottom0left04px rgba0studios sony picturescentrebackgroundcolortransparentborderstylesolidbordercolorrgba40 160 176ideanormal 700imagebutton1datastatehoveredprojects teacherdirected by anthonynew teachingstylek3rcnv43imageitemlink1backgroundcolorrgba255backgroundcolortransparentborderstylesolidbordercolorrgba226 28backgroundcolor fffffffeature animationselectdatapreviewhoverdesign28 33 1production designernew teaching centresony picturesborderwidth3px backgroundcolortransparentborderstylesolidbordercolorrgba40ffffffpixarmetakeywordsseopagetitleseoidea academyfontnormaldesign clients includefeature animation marveltextaligncenterstylek0nqa0jkbgvideogames illustration conceptillustrationnormalf052635normal normalvideogamesoverflowhidden249 1backgroundcolorrgba255digital and traditionalol ulchristov art directordevelopment artistselectdatapreviewfocus7auto0simagebutton1datastatepressed16diezincludeopacity028 33positionabsolutetop0right0bottom0left0borderradius0displaynonepositionfixed importantleftauto importantzindex50development masterinternational design entertainmentstylekf6nx771label249 1backgroundcolorrgba255 255dreamworks blue skyartfuturaltw01booksansserif17px14emacademypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visualpositionfixed importantleftauto05svisualdirectedultxtnew olnormal normal 17px14emstylek6hvcdw9labelcontentart directorteacherstylek4b8y881navcontainerrgba255 255 25506pixarmetakeywordsseopagetitleseoideaclients includemaster animation videogamescalc100 980px 0505positionstaticboxshadow000 0 0traditional46 46 1stylek4b8y881navcontainerarrow stylek4b8y881navcontainersvgcontainer255 255 1stylek4b8y881navcontainerarrowstylek4b8y881navcontainerrightdirectionopacity0 imagebutton1datastatepressed0px17teacher of drawingnormal 12px14em futuraltw01booksansserifparticlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visual development44 46artist walt disney0 0 0scuroolbackgroundcolortransparentborderstylesolidbordercolorrgba226 28 3333 1normal 17px14emdirector and production1backgroundcolorrgba255 25505s easeart riot82 99vardreamworksacademypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixarourfontnormal normal normaltopautobottom0pictures animationstylek4b8y881navcontainersvgcontainer160 176stylekf6nx74sinputborderwidth1pxanimation videogamesactivisionyearshelveticaw01lighthelveticaw02lightsansserifinclude dreamworks blue1bordersolidartsstylek6hvcdw9labelwrapperwalt disneyimportantleftauto importantzindex5011characterimportantdreamworks blueselectdataerrortrueimagebutton1defaultimagenewborderwidth2pxbackgroundcolortransparentborderstylesolidbordercolorrgba40 160dinnextw01lightdinnextw02lightdinnextw10lightsansserifmargin0lineheightnormalletterspacingnormal12px14em futuraltw01booksansserif13stylek6kjen7gbgopacity1transitionopacitymarvel studios sonycoursesamp10pxanthony christovartist for animationcentre for digitalclients include dreamworks1backgroundcolorrgba255 255 255backgroundcolorrgba255importantzindex501stylek4b8y881navcontainercenterdirectionmargin0lineheightnormalletterspacingnormal txtnewdinnextw01lightdinnextw02lightdinnextw10lightsansserif color2f2e2e0 06onewaltcolorfffffffontnormal normalfontnormal normal 700anthonyanimation videogames illustrationfont1pxmasterarts directedb0b0b0rgba255 255stylekf6nx771linkborderwidth3pxdisney featuredevelopment master animationstudypaintingnormal normal 16px14emtxtnew ulborderwidth1px backgroundcolortransparentborderstylesolidbordercolorrgba226selectdatapreviewerrorfontnormal normalstudios0 016px14em helveticaw01lighthelveticaw02lightsansserifillustration concept artentertainmentrgba0 0255 1visual developmentblue skycalc100picturesmarginleft calc100 980pxstrc1dataresponsivemargin0stylejw0hb2y8imageitemlinkvisual development master14stylek6hvcdw9linkselecthoverskyscuro negcolorffffffborderwidth3px backgroundcolortransparentborderstylesolidbordercolorrgba40 160stylejw0hb2y8imageitemzoomultxtnewstylek3rcnv43imageitemzoomnormal normal normaldisneyacademydrawingselectdatapreviewerror stylek4b8y881navcontainerarrowdesign clientsdigital49stylek4b8y881navcontainerleftdirectiondevelopmentanimation marvel studiosmarvel studioscolorfffffffontnormal normal normalteaching centrefont normal normalparticlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visualanimation and entertainmentnormal 16px14emillustration conceptlb1itemscontainer04ssonyopacity1transitionopacity 04s ease150 0 06stylek4b8y881navcontainerarrowmoorearts academypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloatingblizzardbackgroundcolorrgba255 255rgba0 0 0margintop13pxdisney feature animation249 249solid46 1development artist waltriot blizzardleft10pxright10pxartist4px rgba0 0backgroundcolorrgba255 255 255productionstylekf6nx76ftextareaconcept art riot2borderwidth2px borderstylesolidbordercolorrgba249colordrawing paintinginternationalpositionstaticboxshadow000 0border0sony pictures animationdinnextw01lightdinnextw02lightdinnextw10lightsansserif color6e6968designerstylek4b8y881repeaterbuttonlabelconcept art04s ease 0sborderradius0workshopscolor fffffffont normal980pximportantleftauto1borderradius012px14emfeatureentertainment projectsacademypageuriseohomeenhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloatingart riot blizzardpositionstaticboxshadow000projects12rgba47rgba47 4617px14em futuraltw01booksansserifinclude dreamworks14px14emborderwidth1px backgroundcolortransparentborderstylesolidbordercolorrgba226 28industryworkshop4pxpixarmetakeywordsseopagetitleseoidea academy international1px 4pxacademy internationalrgba47 46 461 stylek4b8y881navcontainer1 0pxriotprofessionalyounormal 16px14em helveticaw01lighthelveticaw02lightsansserifnowimagebutton1activeimagergba0academy international designstudios sonybackgroundcoloronline streamingparticlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e25623317524026934154036e7f875e3892dca7115f4b62ba8d11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemjsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixarease 0smarginleft calc100normal 17px14em futuraltw01booksansserifchristov artchristovstylekf6nx771labelwrapperstreamingstylek4b8y881navcontainerarrowstylek4b8y881navcontainerleftdirectionoldirrtl

Longtail Keyword Density for Idea-academy.eu

KeywordsOccurences
margin-left calc100 980px53
calc100 980px 0553
04s ease 0s15
font normal normal11
normal normal normal10
positionstaticbox-shadow000 0 09
fontnormal normal normal9
160 176 18
normal normal 17px14em8
rgba47 46 467
rgba0 0 07
visual development master7
255 255 17
normal normal 16px14em7
master animation videogames6
development master animation6
animation videogames illustration6
videogames illustration concept6
background-colortransparentborder-stylesolidborder-colorrgba40 160 1766
border-width3px background-colortransparentborder-stylesolidborder-colorrgba40 1606
normal 17px14em futura-lt-w01-booksans-serif6
anthony christov art6
christov art director6
46 46 16
new teaching centre5
centre for digital5
digital and traditional5
traditional arts directed5
05s ease 0s5
normal 16px14em helvetica-w01-lighthelvetica-w02-lightsans-serif5
directed by anthony5
academy international design5
international design entertainment5
design entertainment arts5
blizzard online streaming4
border-stylesolidborder-colorrgba249 249 2494
normal normal 12px14em4
marvel studios sony4
border-width2px border-stylesolidborder-colorrgba249 2494
0 0 064
249 249 1background-colorrgba2554
28 33 14
riot blizzard online4
art riot blizzard4
fontnormal normal 7004
concept art riot4
illustration concept art4
0 0 04
255 1 style-k4b8y881navcontainer4
1background-colorrgba255 255 2554
249 1background-colorrgba255 2554
border-width1px background-colortransparentborder-stylesolidborder-colorrgba226 284
background-colortransparentborder-stylesolidborder-colorrgba226 28 334
pixarmetakeywordsseopagetitleseoidea academy international3
director at pixarmetakeywordsseopagetitleseoidea3
entertainment arts academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating3
arts academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar3
academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visual3
particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visual development3
positionfixed importantleftauto importantz-index503
dreamworks blue sky3
1px 4px rgba03
rgba255 255 2553
include dreamworks blue3
disney feature animation3
colorfffffffontnormal normal normal3
opacity1transitionopacity 04s ease3
1bordersolid rgba47 463
normal 12px14em futura-lt-w01-booksans-serif3
4px rgba0 03
director and production3
development artist walt3
artist walt disney3
walt disney feature3
feature animation marvel3
clients include dreamworks3
animation marvel studios3
studios sony pictures3
sony pictures animation3
artist for animation3
background-colorrgba255 255 2553
entertainment projects teacher3
teacher of drawing3
drawing painting color3
color and design3
design clients include3
animation and entertainment3
calc100 980px53
margin-left calc10053
980px 0553
normal normal38
0 029
ease 0s21
04s ease15
fontnormal normal13
255 25513
font normal11
visual development10
46 4610
160 17610
art director9
positionstaticbox-shadow000 09
176 18
normal 17px14em8
46 18
development master7
255 17
margin0line-heightnormalletter-spacingnormal txtnew7
anthony christov7
82 997
normal 16px14em7
rgba0 07
rgba47 467
17px14em futura-lt-w01-booksans-serif6
border-width3px background-colortransparentborder-stylesolidborder-colorrgba406
scuro neg6
illustration concept6
videogames illustration6
animation videogames6
master animation6
christov art6
background-colortransparentborder-stylesolidborder-colorrgba40 1606
normal 7005
16px14em helvetica-w01-lighthelvetica-w02-lightsans-serif5
entertainment arts5
teaching centre5
academy international5
new teaching5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color6e69685
05s ease5
1 style-k4b8y881navcontainer5
international design5
concept art5
traditional arts5
arts directed5
204 2045
design entertainment5
0 064
border-width2px border-stylesolidborder-colorrgba2494
solid rgba2554
33 14
normal 12px14em4
color ffffff4
background-color ffffff4
blue sky4
marvel studios4
studios sony4
clients include4
border-stylesolidborder-colorrgba249 2494
border-width1px background-colortransparentborder-stylesolidborder-colorrgba2264
28 334
background-colortransparentborder-stylesolidborder-colorrgba226 284
online streaming4
blizzard online4
78 784
riot blizzard4
art riot4
wix-image positionabsolutetop0right0bottom0left04
txtnew ul4
187 614
1background-colorrgba255 2554
249 1background-colorrgba2554
249 2494
academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color2f2e2e3
arts academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating3
particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar visual3
pixarmetakeywordsseopagetitleseoidea academy3
dreamworks blue3
include dreamworks3
painting color3
design clients3
walt disney3
drawing painting3
1px 4px3
selectdata-previewerror style-k4b8y881navcontainerarrow3
style-k4b8y881navcontainerarrow style-k4b8y881navcontainersvgcontainer3
colorfffffffontnormal normal3
opacity1transitionopacity 04s3
background-colorrgba255 2553
ultxtnew ol3
ol ul3
1bordersolid rgba473
1 0px3
12px14em futura-lt-w01-booksans-serif3
opacity0 imagebutton1data-statepressed3
4px rgba03
44 463
projects teacher3
importantleftauto importantz-index503
positionfixed importantleftauto3
production designer3
development artist3
artist walt3
rgba255 2553
disney feature3
feature animation3
animation marvel3
sony pictures3
pictures animation3
disney blizzard3
entertainment projects3
character design3
normal71
061
margin-left53
calc10053
980px53
0553
color41
background-color38
137
226
animation23
323
ease21
0s21
positionabsolutetop0right0bottom0left021
development18
txtnew18
art16
04s15
important13
413
academy13
fontnormal13
style-k4b8y881navcontainer13
futura-lt-w01-booksans-serif13
visual12
design12
border-radius012
font11
style-k4b8y881navcontainerarrow11
artist11
510
ul10
610
scuro10
overflowhidden10
solid10
entertainment10
disney10
arts10
idea9
director9
blizzard9
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif9
0px9
christov9
positionstaticbox-shadow0009
concept9
master8
digital8
colorffffff8
78
17px14em8
displaynone8
88
style-kf6nx74sinput8
ffffff8
margin07
pixar7
ol7
anthony7
margin0line-heightnormalletter-spacingnormal7
border-width3px7
var7
character7
illustration7
rgba07
97
107
rgba477
traditional7
1px7
16px14em7
new7
style-kf6nx76ftextarea6
style-k4b8y881navcontainerarrowstyle-k4b8y881navcontainerright-direction6
style-k3rcnv43imageitemlink6
auto6
style-k4b8y881navcontainerarrowstyle-k4b8y881navcontainercenter-direction6
style-jw0hb2y8imageitemlink6
background-colortransparentborder-stylesolidborder-colorrgba406
designer6
style-k4b8y881navcontainerarrowstyle-k4b8y881navcontainerleft-direction6
videogames6
neg6
color6e69686
05s5
115
imagebutton1defaultimage5
imagebutton1hoverimage5
imagebutton1activeimage5
activision5
teaching5
style-k3rcnv43imageitemzoom5
if5
color2f2e2e5
helvetica-w01-lighthelvetica-w02-lightsans-serif5
amp5
directed5
international5
centre5
online5
teacher5
ultxtnew5
style-jw0hb2y8imageitemzoom5
positionabsolutetop0right0bottom0left0border-radius05
border05
workshop5
125
rgba2555
text-alignleft5
text-aligncenter5
painting4
sony4
background-colorrgba2554
10px4
style-k4b8y881repeaterbuttonlabel4
courses4
134
f052634
b0b0b04
style-kf6nx771link4
12px14em4
riot4
studios4
marvel4
projects4
dreamworks4
streaming4
you4
industry4
lb1itemscontainer4
style-kf6nx771label4
style-kf6nx771labelwrapper4
clients4
144
style-k6hvcdw9labelwrapper4
style-k6hvcdw9link4
style-k6hvcdw9label4
1bordersolid4
064
border-width2px4
border-stylesolidborder-colorrgba2494
drawing4
sky4
wix-image4
1background-colorrgba2554
opacity04
blue4
include4
154
164
margin-top13px4
background-colortransparentborder-stylesolidborder-colorrgba2264
border-width1px4
nielson3
walt3
particlesvideoidvideo11062b03c50f8fe4a34cc297a984e483a282efqualitiesquality480pwidth854height480formatsmp4webmquality720pwidth1280height720formatsmp4webmquality1080pwidth1920height1080formatsmp4webmposterimagereftypeimageidc1dmpdesktopposterimagerefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altopacity1duration18looptrueautoplaytruepreloadautomutetrueartistidnamecolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri11062b03c50f8fe4a34cc297a984e483a282eff000jpgdescriptionpublic8e256233-1752-4026-9341-54036e7f875e3892dca7-115f-4b62-ba8d-11a7b220ab76width1920height1080altcolor000000aligntypecenterfittingtypefillscrolltypefixedcoloroverlay02b0adcoloroverlayopacity03ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-jsc3j8ggmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuric8e62db4111f2cdabd4a8c8548cab1991bc77amv2jpgwidth1920height899altadvancedseodatatagstypemetapropsnamekeywordscontentpixar3
feature3
academypageuriseohome-enhidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpk0p8qvuubgmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlefloating3
moore3
pictures3
one3
years3
illustrator3
pixarmetakeywordsseopagetitleseoidea3
strc1data-responsive3
production3
1border-radius03
selectfocus3
selectdata-previewhover3
selecthover3
style-k4b8y881navcontainerleft-direction3
style-k4b8y881navcontainersvgcontainer3
4px3
style-k0nqa0jkbg3
left10pxright10px3
selectdata-errortrue3
173
style-k6kjen7gbg3
topautobottom03
importantz-index503
importantleftauto3
positionfixed3
14px14em3
now3
selectdata-previewfocus3
selectdata-previewerror3
our3
imagebutton1data-statehovered3
workshops3
professional3
become3
study3
box-shadownone3
imagebutton1data-statepressed3
opacity13
strc1inlinecontent3
style-k4b8y881navcontainerright-direction3
oldirrtl3
opacity1transitionopacity3
text-alignright3
colorfffffffontnormal3
avenir-lt-w0185-heavy1475544sans-serif3
style-k4b8y881repeaterbuttondata-statedrop3
content3
style-k4b8y881navcontainercenter-direction3
diez3

Who hosts Idea-academy.eu?

Idea-academy.eu Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Idea-academy.eu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Dec 2020 15:35:38 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1608305738.82310945406116351
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVj1ELE/lLKFr64HWuKhttT6,2d58ifebGbosy5xc FRalut8KL03boH//J6IxZQy 9DfVb5rYCBdmC5MCHB0QyTIGgqFbFMYwiXnFojPwdof6D 0D71BgpIDXQvOE87U aQ=,2UNV7KOq4oGjA5 PKsX47BxIqOBp/BcxgT00NVTD1Qk=,qquldgcFrj2n046g4RNSVO38E53VHF73OUfaaLx5QS1YgeUJqUXtid 86vZww nL,znxyTGNb715cyF9N4jtLDBYE8W21FNTRng7VyH6J3PRAOzfqOOoRoyNC7p4jABRoKjCWKapddFlOEEDxcGowaw==,IaDuTAMGGvhXtruM6nHg6lk6/KBc5eOTZgv2XRUZiFKTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHHLY7AM74j81VOkQ/VxOzyE3WZR1gP1Rwaygktjo5rPQGC9IpAlMOL6hygP6ild81A=,l7Ey5khejq81S7sxGe5Nkxl4dAtDO8IMojkMlkZT45CTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LXlT8qjS5x6WBejJA3 gBVKJllKAqnOke2t/qO6y6PJNG KuK VIZfbNzHJu0vJu,LlHHrtdZwfqSTe7u8ayFI17rh 5jSKExtOuDnohOV/h5mohTL/LvtUz5RpEymIMUD2lwgrC09jzq3Yd5taHCYg==,l7Ey5khejq81S7sxGe5Nkxl4dAtDO8IMojkMlkZT45CTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,vnnyTBxZ51OQwVc1vV5ZXM4og00/h/RTPzjIvWGFPzuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLAMprEUIZxq9zKnG Z7Ipme3Yyo2VZAbRPWZTGomcPLInbYcVZJVJ7BFfdI oNcB1Q==
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

Idea-academy.eu Domain Nameserver Information

HostIP AddressCountry
ns13.wixdns.net 216.239.38.101
ns12.wixdns.net 216.239.36.101


Need to find out who hosts Idea-academy.eu?


Domain Registration (WhoIs) information for Idea-academy.eu

 % The WHOIS service offered by EURid and the access to the records
% in the EURid WHOIS database are provided for information purposes
% only. It allows persons to check whether a specific domain name
% is still available or not and to obtain information related to
% the registration records of existing domain names.
%
% EURid cannot, under any circumstances, be held liable in case the
% stored information would prove to be wrong, incomplete or not
% accurate in any sense.
%
% By submitting a query you agree not to use the information made
% available to:
%
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or
% otherwise;
% - target advertising in any possible way;
%
% - to cause nuisance in any possible way to the registrants by sending
% (whether by automated, electronic processes capable of enabling
% high volumes or other possible means) messages to them.
%
% Without prejudice to the above, it is explicitly forbidden to extract,
% copy and/or use or re-utilise in any form and by any means
% (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior
% and explicit permission by EURid, nor in any attempt hereof, to apply
% automated, electronic processes to EURid (or its systems).
%
% You agree that any reproduction and/or transmission of data for
% commercial purposes will always be considered as the extraction of a
% substantial part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept
% that EURid can take measures to limit the use of its WHOIS services
% in order to protect the privacy of its registrants or the integrity
% of the database.
%
% The EURid WHOIS service on port 43 (textual whois) never
% discloses any information concerning the registrant.
% Registrant and on-site contact information can be obtained through use of the
% webbased WHOIS service available from the EURid website www.eurid.eu
%
% WHOIS idea-academy.eu
Domain: idea-academy.eu
Script: LATIN

Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

On-site(s):
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

Registrar:
Name: Tucows.com Co.
Website: http:///www.domainhelp.tucows.com/

Name servers:
ns13.wixdns.net
ns12.wixdns.net

Please visit www.eurid.eu for more info.

Websites with Similar Names

Idea-101.com
404 Not Found
Idea-720.com
idea-720.com
Idea-a.net
idea-a.net – このドメインはお名前.comで取得されています。
Idea-abolish.xyz
idea-abolish.xyz – ??????????.com??????????
Idea-academy.eu
IDEA Academy - International Design & Entertainment Arts Academy
Idea-according.top
idea-according.top
Idea-accumulation.xyz
idea-accumulation.xyz – ??????????.com??????????

Recently Updated Websites

Mamashotel.de (2 seconds ago.)Dance4two.nl (3 seconds ago.)Terhits.info (4 seconds ago.)Tareasenlinea.mx (6 seconds ago.)Nikkore.com (7 seconds ago.)Maneliskids.online (7 seconds ago.)Queseriafranciscobada.com (10 seconds ago.)Pinoydate.com (12 seconds ago.)E-kabalah.org (13 seconds ago.)Beplay253.com (13 seconds ago.)Bmakbilisim.com (13 seconds ago.)Ihaveantibodiesnowwhat.com (14 seconds ago.)Edprose.com (14 seconds ago.)Thankstor.com (16 seconds ago.)Vremyatain.ru (17 seconds ago.)Northflblues.com (19 seconds ago.)Kaigosoft.jp (20 seconds ago.)Fultibolplay.net (20 seconds ago.)Cheapestflightsout.org (21 seconds ago.)Theauwest.com (23 seconds ago.)Chartwat.com (25 seconds ago.)Jjzhwd.com (26 seconds ago.)Dionysos.website (27 seconds ago.)Gatoguai.com (28 seconds ago.)Fizzy-filly.com (28 seconds ago.)Orthodornach.ch (29 seconds ago.)Marvintheband.com (31 seconds ago.)Rocketgg.net (32 seconds ago.)Carterlodge.com (33 seconds ago.)Whatdoyoudesire.online (35 seconds ago.)

Recently Searched Keywords

t co (1 second ago.)add to cartadd to cart (1 second ago.)joyride (3 seconds ago.)safety recall information (4 seconds ago.)imo gmdss regulations (4 seconds ago.)cart 0 items (7 seconds ago.)h5游戏 (8 seconds ago.)carts will restore most services on september 01, 2020 (9 seconds ago.)昆明螺蛳湾 (10 seconds ago.)technology which (11 seconds ago.)el sexo (12 seconds ago.)pagelayer-address (14 seconds ago.)phillips curve (17 seconds ago.)ditto 2 (17 seconds ago.)bảng huỳnh quang (18 seconds ago.)animaltype horses categorytype (19 seconds ago.)twin xlpublictitletwin xloptionstwin (21 seconds ago.)between artificial (22 seconds ago.)ohne titel (23 seconds ago.)margin-bottom 0px (23 seconds ago.)248625032454 2489249424882495247224942480 24882457250924552503 (24 seconds ago.)azdes (25 seconds ago.)présentation du lycée (27 seconds ago.)впм-01 (27 seconds ago.)sales consulting (28 seconds ago.)tamar braxton net worth (28 seconds ago.)event  (28 seconds ago.)kmrjibon (29 seconds ago.)couchsurfing (31 seconds ago.)popover-content other-social-wrap (31 seconds ago.)