Registration Domain & Web Hosting Murah Berkualitas | IDreg

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2021-01-26

IDreg adalah media jasa register domain dan web hosting murah, cepat, handal dan berkualitas yang sangat sesuai dengan kebutuhan anda.


Domain summary

Domain label
idreg
Domain extension
net
Domain registered:
2012-12-28
Domain updated:
2020-12-24
Domain expires:
2021-12-28
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is idreg.net ranked relative to other sites:

Percentage of visits to idreg.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Idreg.net registered?
A: Idreg.net was registered 8 years, 1 month, 4 weeks, 1 day, 15 hours, 36 minutes, 27 seconds ago on Friday, December 28, 2012.
Q: When was the WHOIS for Idreg.net last updated?
A: The WHOIS entry was last updated 2 months, 2 days, 15 hours, 36 minutes, 27 seconds ago on Thursday, December 24, 2020.
Q: What are Idreg.net's nameservers?
A: DNS for Idreg.net is provided by the following nameservers:
  • ns1.idreg.net
  • ns2.idreg.net
Q: Who is the registrar for the Idreg.net domain?
A: The domain has been registered at PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM.
Q: What is the traffic rank for Idreg.net?
A: Idreg.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Idreg.net each day?
A: Idreg.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Idreg.net resolve to?
A: Idreg.net resolves to the IPv4 address 172.96.190.91.
Q: In what country are Idreg.net servers located in?
A: Idreg.net has servers located in the Canada.
Q: What webserver software does Idreg.net use?
A: Idreg.net is powered by Nginx webserver.
Q: Who hosts Idreg.net?
A: Idreg.net is hosted by Versaweb, LLC in Ontario, Fergus, Canada, N1m.
Q: How much is Idreg.net worth?
A: Idreg.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Idreg.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Idreg.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Idreg.net

H1 Headings

15 :
  1. Semua Kebutuhan
  2. dalam satu Paket
  3. Berbasis
  4. Wordpress
  5. Saat Daftar
  6. Langsung Aktif
  7. Private Server
  8. Lebih Canggih
  9. Pilihan paket yang bervariasi untuk anda
  10. Hosting Indonesia
  11. Hosting USA
  12. Hosting Singapore
  13. Wordpress Hosting
  14. Virtual Private Server
  15. Fitur & Layanan Service

H2 Headings

9 :
  1. Rp10rb/bln
  2. Rp20rb/bln
  3. Rp25rb/thn
  4. Rp50rb/bln
  5. 10rbper bulan
  6. 10rbper bulan
  7. 40rbper bulan
  8. 47rbper bulan
  9. 77rbper bulan

H3 Headings

5 :
  1. Hosting Berkelas
  2. Hosting Paket
  3. Domain Murah
  4. System Virtual
  5. Lebih dari 250+ Aplikasi siap Install Cukup hanya dengan 1 Klik

H4 Headings

18 :
  1. Jaminan Uptime 99.9%
  2. Setup Instan & Bebas Kontrak
  3. SSD Disk Space
  4. Complete Data Protection
  5. Litespeed Webserver
  6. Gratis Support Selamanya
  7. Control Panel
  8. Garansi 15 hari Uang kembali
  9. Fitur hosting yang lengkap tersedia di setiap paket
  10. Gratis Fitur proteksi pencurian nama domain
  11. Full akses, semua fitur anda yg akan mengelola
  12. Hosting Packages
  13. Billing & Order
  14. Tutorials
  15. Metode Pembayaran
  16. Domain paket
  17. Support
  18. Info terkini

H5 Headings

5 :
  1. mulaidari
  2. mulaidari
  3. mulaidari
  4. mulaidari
  5. Daftarkan Brand Anda:

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

74:

Links - Internal (nofollow)

0:

Links - Outbound

5:

Links - Outbound (nofollow)

0:

Keyword Cloud for Idreg.net

webmurahshared hostinghostinglitespeed webserversiapsehinggalihat paket orderwebserverlihat paketcontrol panellitespeedprivatedislebihdomainunlimitedgbtrafik noadalahandawebsite andapanellitespeedsystemwebserverunlimitedsubdomainsinglebandwidthcpaneldariweb hostingwebserverunlimited subdomainsingle domainunlimitedordersajabrandyangbandwidthcpanel control panellitespeedpembayaranorder sekarangwebsitelihatshareduntukpaket orderdomainkamitypedenganlitespeednobandwidthcpanel controlhosting murahdanidreglayanansekarangwebserverunlimited subdomainsinglecontrolpaketsubdomainsingle domainunlimitedtrafikserverhargapaket order sekarangfitur

Who hosts Idreg.net?

Idreg.net Hosting Provider Information

Hosted IP Address:172.96.190.91
Hosted Hostname:serv.idreg.net
Service Provider:Versaweb, LLC
Hosted Country:CanadaCA
Location Latitude:43.7001
Location Longitude:-80.3664
Webserver Software:nginx

Is "Versaweb, LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Versaweb, LLC
0.0225%

HTTP Header Analysis for Idreg.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 26 Jan 2021 18:56:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip
Vary: Accept-Encoding
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Referrer-Policy: no-referrer-when-downgrade
Content-Security-Policy: upgrade-insecure-requests
Strict-Transport-Security: max-age=15768000;

Idreg.net Domain Nameserver Information

HostIP AddressCountry
ns1.idreg.net 174.36.198.66United States United States
ns2.idreg.net 74.86.9.50United States United States


Need to find out who hosts Idreg.net?


Domain Registration (WhoIs) information for Idreg.net

 Domain Name: IDREG.NET
Registry Domain ID: 1769377444_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2020-12-24T15:31:08Z
Creation Date: 2012-12-28T09:57:49Z
Registrar Registration Expiration Date: 2021-12-28T09:57:49Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1.idreg.net
Name Server: ns2.idreg.net
DNSSEC: signedDelegation
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-26T19:01:40Z

Websites with Similar Names

Idreg.co.id
Registration Domain & Web Hosting Murah Berkualitas | IDreg
Idreg.net
Registration Domain & Web Hosting Murah Berkualitas | IDreg
Idregal.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Senfitness.com (2 seconds ago.)Delife.de (17 seconds ago.)Midwestmakersmarkets.com (19 seconds ago.)Rixant.com (19 seconds ago.)Travelwithclass.org (21 seconds ago.)Sicilsoletrasporti.com (23 seconds ago.)Frenchienetwork.com (23 seconds ago.)Layyover.com (25 seconds ago.)Alloutgym.com (26 seconds ago.)T-d-s.co.jp (30 seconds ago.)Neomstockists.com (30 seconds ago.)G13338.com (31 seconds ago.)Hostingweb.info (32 seconds ago.)Coinbetonline.com (33 seconds ago.)Spaninvestments.com (34 seconds ago.)Kaffee.support (34 seconds ago.)Paris-international.com (35 seconds ago.)Evaswild.net (35 seconds ago.)Winmorenow.com (36 seconds ago.)Villainmediacaorealestates.com (39 seconds ago.)Yourstatetaxpartner.com (41 seconds ago.)Alanbaa.net (42 seconds ago.)E-childdaycare.website (42 seconds ago.)Thoitrangnu.net (44 seconds ago.)Swipalyzer.com (44 seconds ago.)Inbox.show (47 seconds ago.)Besplatneigrice.com (47 seconds ago.)Oiweimei.com (49 seconds ago.)Alabamasocialservices.org (49 seconds ago.)Therisesisterhood.com (49 seconds ago.)

Recently Searched Keywords

college (4 seconds ago.)paniere a linge maison du monde (11 seconds ago.)id 923 (13 seconds ago.)var j (13 seconds ago.)flash lights (13 seconds ago.)leader forrester wavetrade (13 seconds ago.)fi (18 seconds ago.)ue (28 seconds ago.)knh thnh (33 seconds ago.)digital (39 seconds ago.)-o-linear-gradientrgba1971971971 45 rgba1971971971 (43 seconds ago.)helicopterreporter (45 seconds ago.)04s ease-in-out (47 seconds ago.)ste (53 seconds ago.)allison moved (57 seconds ago.)криптовалюта (58 seconds ago.)epic (59 seconds ago.)meet the speakers (1 minute 2 seconds ago.)merch-wrap merch betweenborder (1 minute 4 seconds ago.)bo (1 minute 7 seconds ago.)hulkapps-tooltip-innermultiswatch-tooltip (1 minute 7 seconds ago.)ota yhteytt (1 minute 14 seconds ago.)οι υπαατ, μάκης βορίδης και υφοικ, απόστολος βεσυρόπουλος δίνουν διέξοδο στους διήμερους αποσταγματοποιούς (1 minute 18 seconds ago.)mat (1 minute 18 seconds ago.)mbyh (1 minute 19 seconds ago.)mk ii (1 minute 20 seconds ago.)function item (1 minute 27 seconds ago.)гигиена (1 minute 29 seconds ago.)que (1 minute 29 seconds ago.)chromeias (1 minute 31 seconds ago.)