Imlea.org Favicon Imlea.org

Imlea.org Website Thumbnail
Checking...
Indiana Middle Level Education Association / Homepage

Safety: Low trust score
Year Founded: 2005
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-22
Category: This site has not been categorized yet

The Indiana Middle Level Education Association is dedicated to promoting, improving, and supporting middle level education.


Domain summary

Domain label
imlea
Domain extension
org
Domain registered:
2005-03-24
Domain updated:
2020-10-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is imlea.org ranked relative to other sites:

Percentage of visits to imlea.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Imlea.org registered?
A: Imlea.org was registered 15 years, 8 months, 9 hours, 14 minutes, 39 seconds ago on Thursday, March 24, 2005.
Q: When was the WHOIS for Imlea.org last updated?
A: The WHOIS entry was last updated 1 month, 2 days, 9 hours, 14 minutes, 39 seconds ago on Thursday, October 22, 2020.
Q: What are Imlea.org's nameservers?
A: DNS for Imlea.org is provided by the following nameservers:
  • ns55.worldnic.com
  • ns56.worldnic.com
Q: Who is the registrar for the Imlea.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Imlea.org?
A: Imlea.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Imlea.org each day?
A: Imlea.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Imlea.org resolve to?
A: Imlea.org resolves to the IPv4 address 52.206.191.232.
Q: In what country are Imlea.org servers located in?
A: Imlea.org has servers located in the United States.
Q: What webserver software does Imlea.org use?
A: Imlea.org is powered by Awselb/2.0 webserver.
Q: Who hosts Imlea.org?
A: Imlea.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20149.
Q: How much is Imlea.org worth?
A: Imlea.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Imlea.org?

Imlea.org Hosting Provider Information

Hosted IP Address:52.206.191.232
Hosted Hostname:ec2-52-206-191-232.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:awselb/2.0

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Imlea.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: awselb/2.0
Date: Thu, 22 Oct 2020 20:36:26 GMT
Content-Type: text/html
Content-Length: 134
Connection: keep-alive
Location: https://www.imlea.org:443/

Imlea.org Domain Nameserver Information

HostIP AddressCountry
ns55.worldnic.com 207.204.40.128
ns56.worldnic.com 207.204.21.128


Need to find out who hosts Imlea.org?


Domain Registration (WhoIs) information for Imlea.org

 Domain Name: IMLEA.ORG
Registry Domain ID: D105951776-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-01-24T09:29:23Z
Creation Date: 2005-03-24T15:22:53Z
Registry Expiry Date: 2021-03-24T15:22:53Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS55.WORLDNIC.COM
Name Server: NS56.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-22T20:35:27Z

Imlea.org Free SEO Report

Website Inpage Analysis for Imlea.org

H1 Headings

6 :
  1. Indiana Middle Level Education Association
  2. Upcoming Events
  3. Tomorrow
  4. Saturday
  5. Sunday
  6. Quick Links

H2 Headings

1 :
  1. Address

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-5173826-6

Links - Internal

59:
  1. Imlea District Home
    https://www.imlea.org/Domain/8
  2. Imlea Sign In
    https://www.imlea.org/site/Default.aspx?PageType=7&SiteID=8&IgnoreRedirect=true
  3. Imlea Home
    http://imlea.org/Page/9
  4. Imlea About IMLEA
    http://imlea.org/domain/35
  5. Imlea Board Members
    http://imlea.org/domain/35
  6. Imlea From Our President
    http://imlea.org/domain/36
  7. Imlea IMLEA's History
    http://imlea.org/domain/37
  8. Imlea Videos from IMLEA
    http://imlea.org/domain/38
  9. Imlea AMLE Affiliation
    http://imlea.org/domain/61
  10. Imlea Schools to Watch
    http://imlea.org/domain/45
  11. Imlea 2020-21 Application for First-Time Designation
    http://imlea.org/domain/71
  12. Imlea 2020-21 Application for Redesignation
    http://imlea.org/domain/73
  13. Imlea Indiana DOE TAP Program
    http://imlea.org/domain/67
  14. Imlea Partners
    http://imlea.org/domain/13
  15. Imlea Corporate Partnerships
    http://imlea.org/domain/13
  16. Imlea Program Partners
    http://imlea.org/domain/14
  17. Imlea INSPIRE3 (formerly genOn IN)
    http://imlea.org/domain/10
  18. Imlea INSPIRE3
    http://imlea.org/domain/10
  19. Imlea Member Schools
    http://imlea.org/domain/41
  20. Imlea Membership Lists
    http://imlea.org/domain/41
  21. Imlea Publications
    http://imlea.org/domain/43
  22. Imlea IMLEA Newsletter
    http://imlea.org/domain/43
  23. Imlea IMLEA Monday Minute
    http://imlea.org/domain/44
  24. Imlea Resources
    http://imlea.org/domain/20
  25. Imlea Finding EDU Funds
    http://imlea.org/domain/20
  26. Imlea Educational Links
    http://imlea.org/domain/21
  27. Imlea Members Strategies and Tips
    http://imlea.org/domain/22
  28. Imlea Middle Level Websites
    http://imlea.org/domain/23
  29. Imlea Middle Level Job Openings
    http://imlea.org/domain/24
  30. Imlea Recommended Resources
    http://imlea.org/domain/25
  31. Imlea Resources to Build Your PLN
    http://imlea.org/domain/26
  32. Imlea Blogs
    http://imlea.org/domain/60
  33. Imlea Join Us!
    https://www.imlea.org/domain/29
  34. Imlea Join IMLEA online
    https://www.imlea.org/domain/29
  35. Imlea Membership Application Form
    http://imlea.org/domain/29
  36. Imlea Conference & Other Events
    http://imlea.org/domain/32
  37. Imlea IMLEA Annual State Conference
    http://imlea.org/domain/32
  38. Imlea Workshops
    http://imlea.org/domain/33
  39. Imlea Calendar
    http://imlea.org/domain/30
  40. Imlea Recognition
    http://imlea.org/domain/18
  41. Imlea IMLEA "Star Awards"
    http://imlea.org/domain/18
  42. Imlea Legislative Updates
    http://imlea.org/domain/39
  43. Imlea PBL
    http://imlea.org/domain/15
  44. Imlea Middle Level Problem Based Learning
    http://imlea.org/domain/16
  45. Imlea To Review
    http://imlea.org/domain/56
  46. Imlea Uncategorized
    http://imlea.org/domain/56
  47. Imlea Slideshows
    http://imlea.org/domain/58
  48. Imlea Champions Together in the Middle
    http://imlea.org/domain/63
  49. Imlea Champions Together
    http://imlea.org/domain/63
  50. Imlea Shining Star Awards
    http://imlea.org/domain/65
  51. Imlea AMLE Affiliate
    http://imlea.org/domain/72
  52. Imlea Resources for Remote Learning & Return to School
    http://imlea.org/site/Default.aspx?PageID=132
  53. Imlea Check out the benefits here!
    http://imlea.org/cms/lib/IN50000001/Centricity/Domain/8/amle imlea dual.pdf
  54. Imlea AMLE Virtual Conference Live Sessions
    https://www.imlea.org/site/Default.aspx?PageID=10&DomainID=8#calendar59/20201023/event/2088
  55. Imlea AMLE Virtual Conference Live Sessions
    https://www.imlea.org/site/Default.aspx?PageID=10&DomainID=8#calendar59/20201024/event/2088
  56. Imlea AMLE Virtual Conference Live Sessions
    https://www.imlea.org/site/Default.aspx?PageID=10&DomainID=8#calendar59/20201025/event/2088
  57. Imlea View Calendar
    http://imlea.org/Page/10
  58. Imlea Click here to join IMLEA
    https://www.imlea.org/domain/29
  59. Imlea Site Map
    http://imlea.org/site/Default.aspx?PageType=15&SiteID=8&SectionMax=15&DirectoryType=6

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Imlea.org

groupyearsessionsnbspgroupby renderloc0fromrenderloc0enablequirksmode0taguidialogoverlaybasemodal uidialogoverlaycontent doesnttargetview looksvar raisedbydatepicker etargetclasslistcontainsdatepickerdocumentreadyfunctionsubgroupyear groupmonthviewtouse ifhidmiidsidebarlistviewlengthsublistattrariahidden trueattrariaexpanded falsevar swalertopenchevronrenderloc 0alertboxid noclick elsethisclick function loadgroupeddatacontainer5estopimmediatepropagation epreventdefault checkfocus etargetblurcheckscriptmoduleviewcheckscriptmustacheuluibreadcrumbsescapemodulecontentviewtag viewtouse lookslist view definedreturnmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbspnoclickpageid 9 varestopimmediatepropagationuidialogoverlayoklengthtargetview hidmiiddetailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceidhid miiddata var successflexdataid groupyear groupmonthbodyonkeydown uidialogoverlaybasemodalestopimmediatepropagation epreventdefault6groupby renderloc0fromrenderloc0enablequirksmode0tag tag9 var2 chksidebar settimeoutfunctioncheckdomainid 8sidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miidhidden sidebar listetargetblur etargetclasslistremovefocus documentreadyfunctionmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctiongroupmonth groupby taghidhidden detail viewnavenablequirksmode0viewid viewtouseif ekeycodehid miid sidebarlistviewvalmiid pmi tagopen alert8 var pageidelse removenovar failure callcontrollerfailureresult0errormessageremove focus etargetblurbodyonkeydown uidialogoverlaybasemodal uidialogoverlaytargetviewlength 0 targetviewpmi renderloc0fromrenderloc0groupyear groupyearmodulecontent miid findtabindexfirstfocusdefinedgroupbyfield groupby enablequirksmode0viewid8 varifhidmiidsidebarlistviewlengthalerteventkeycodegroupby enablequirksmode0viewid viewtouselistgroupby tagloadtaggeddatacontainer miid pmisidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceidview definedrenderloc0fromrenderloc0tagiftargetviewsectionfunction loadgroupeddatacontainer miidaattrtargetenablequirksmode0viewidviewtouse containervar viewtouse ifhidmiidsidebarlistviewlength0 ifsettimeoutfunction modulecontent miidflexdataidmoderated content doesntdialogdetail viewvar alertboxid uiswalertattridif raisedbydatepickersureswalertopen uiswalertlengthescuiswalertattridrenderloc0fromrenderloc0enablequirksmode0tag tag viewidno ifideventalertboxidvar failureview targetviewlidatabcsid activeselectorid2swalertopen0 targetviewfunction ifeventdateidtrueattrariaexpanded falseetargetclasslistremovefocus documentreadyfunctionthischildrenulmiid findtabindexfirstfocus 200channelsublistattrariahiddencheck to makechksidebar functionalert vardetailalertboxid noclickvar domainid0 viewtouse hidflexdataid flexdataid groupyearenablequirksmode0viewidviewtouse container 2iftargetview undefined targetviewlengthepreventdefault closefunction loadgroupeddatacontainerclose dialog uidialogoverlayclosemodalvisiblelastclick8id of opengroupbyfielddocumentonmouseoverif trimsublisthtml sublistattrariahiddeniseditloadtaggeddatacontainer miidsublistvar miidselectschoolulheighttargetviewalertboxid uiswalertattrid clickdialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthgroupmonth groupbyfield4dialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentuserregidokclick elsegroupmonth groupmonth groupbyfieldtrueattrariaexpandedthisclick functionviewtouse hid miidvar successamle virtual conference13 thisclickelse if ekeycodecheck if escvar pageidfunction loaddatacontainer miidmoderateddomainid 8 varsublist thischildrenul iftag containertag taggroupmonth groupbyfield groupbyif alertboxid oklengthtag viewiddata varpmi renderloc0fromrenderloc0tag tagrenderloc0fromrenderloc0enablequirksmode0tagviewtouseakeypressfunctionepmibuttonproplinkhrefvardataamle virtualliveadded to checkesc was pressedactiveselectorid aattrhrefgroupyear groupmonth groupmonthadduiswalertlength ifchksidebaretargetclasslistremovefocus9 var renderlocdialog uidialogoverlayclosemodalvisiblelastclickdialog uidialogoverlayclosemodalvisiblelastclick elsedomainidvar pageid 9strcookiemiid pmidoesnt bleedvar renderloc 0sure moderated contentmiid pmi flexdataiddoesnt bleed throughif raisedbydatepicker estopimmediatepropagationtargetview hidmiiddetailviewvalgroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagmiidfinduiwidgetdetailfinduiarticleappendnbspswchanneldropdownhide thisremoveclasshoverhrefalertboxid okclickthisclickloaddatacontainer miidgroupbyviewtouse tagtargetviewlength 0var datauidialogoverlayclosemodalvisiblelastclick else removeswchanneldropdownhide thisremoveclasshover varvirtualview var viewtouseoklength 0parentzindexclassdocumentreadyfunction taglist limake surepagenavigationstatecookie functionmaketag tag containerclosefindtabindexfirstfocus 200trimsublisthtml sublistattrariahidden trueattrariaexpandedepreventdefault get iddetail view definedaddoffcanvasmenuheightforsitenavlooksif swalertopen 1pageid 9hidmiiddetailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miidrenderloc0fromrenderloc0enablequirksmode0tag tagdialogoverlaywindowlargemodalbodymoderatecontentlengthviewiduidialogoverlay uiswalertdialogoverlaywindowlargemodalbodymoderatecontentlength 0miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctiondocumentonclickfunction epmi tagfailure callcontrollerfailureresult0errormessage0 var3doesntamlepageidswalertopen 1 ifdocumentreadyfunction taglistsidebarakeypressfunctione ifewhich 130 var miidlist viewchksidebar function loadtaggeddatacontainertargetviewlengthelse ifuiswalertlength if swalertopenfunction loaddatacontainerdocumentreadyfunction var domainidcontainer 2 chksidebaractiveselectoridsidebar listgroupmonth groupmonthsetlidatabcsidchksidebar function loaddatacontainernavsuiswalertvar sublist thischildrenulalertboxid okclick elsegroupyear groupyear groupmonthekeycodeestopimmediatepropagation epreventdefault closeulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedthisremoveclasshovertag enablequirksmode0viewidviewtouse containergroupbyfield groupbyclick okli akeypressfunctionevar data varekeycode 27 escapefailuresuccess failureviewtouse looksthisremoveclasshover var sublistlicollapsibleeachfunction2 chksidebar functiongroupby targetviewdocumentonmouseoutdatepickerhidden sidebare vartagcontentsuccesscontainer 2miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache0 targetview lookspagemoduleinstanceidpmi renderloc0fromrenderloc0tagifhidmiidsidebarlistviewlength 0 viewtouse27 escape keyifhidmiidsidebarlistviewlength 0settimeoutfunction0keyifewhichvar swalertopen uiswalertlengthmiidtag iftargetview undefinedourraisedbydatepicker etargetclasslistcontainsdatepickertargetview container 2pmi flexdataid flexdataid0 viewtousethrough the dialogalert var alertboxidgroupyear groupmonth groupbyvirtual conference livevar sublistpmi renderloc0fromrenderloc0groupyeartag viewid targetviewkey estopimmediatepropagationnavs activeselectoridgetlimiid pagemoduleinstanceid pmifocusfunction loadtaggeddatacontainer miidactivechannelnavtypeifewhich 13 thisclicketargetclasslistcontainsdatepicker if raisedbydatepickeractivesublist thischildrenulvar viewtousenoclick elseviewtouse tag tagpmi groupyearview var0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspopen alert varswinnerwrapheightrenderloc0fromrenderloc0groupyear groupyear groupmonthvar raisedbydatepickerbuilder viewgroupby tag viewtouseloadgroupeddatacontainer miid pmiremove focustargetview tagif trimsublisthtmlrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtousetag iftargetviewactive classhidmiiddetailviewvalzindexflexdataid flexdataidetargetclasslistcontainsdatepicker ifopenloaddatacontainer2 chksidebargroupmonth groupby targetviewetaglist licontaineraddedescape key estopimmediatepropagationuiswalertlengthgroupyear groupyeardatepicker vare var swalertopenconference live sessionsmiid pmi groupyearundefineddatepicker var raisedbydatepickerok or nomake sure moderatedakeypressfunctione ifewhichopenpagesubmenuthisparentsettimeoutfunction modulecontentelse alertboxidchksidebar settimeoutfunction modulecontentpagemoduleinstanceid pmi flexdataidgroupby enablequirksmode0viewidchksidebar settimeoutfunctionno if alertboxidmoderated contentactiveselectorid aattrtargethidden detailraisedbydatepickerclickthisremoveclasshover varhidmiiddetailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceidhiddenfunctionokclickbodyonkeydownbuilder view varsidebar list viewuiswalert function eelse remove focusalertboxid oklengthgetcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miidpmi groupyear groupmonthuiswalert functiontargetview tag iftargetviewgroupmonthepreventdefault close dialog1miid sidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceidkey estopimmediatepropagation epreventdefaultelserenderloc0fromrenderloc0groupyear groupyearview targetview hidmiiddetailviewvalmodulecontent miidraisedbydatepicker estopimmediatepropagation0 alertboxidepreventdefault checkmiid sidebarlistviewvalflexdataid groupyear groupyearremovetag viewtouseuiswalertattrid click oksure moderatedloadtaggeddatacontainerpressedgetcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceiduidialogoverlayclosemodalvisiblelastclickmenusidebarlistviewvalraisedbydatepicker estopimmediatepropagation epreventdefaultokclick else alertboxidetargetblurpagenavigationstatecookiepmi flexdataiduiswalertattrid clickuidialogoverlaybasemodal uidialogoverlay uiswalertvar domainid 827 escape13 thisclick functionpressed on datepickernavigationraisedbydatepicker etargetclasslistcontainsdatepicker ifloaddatacontainer miid pmivar alertboxidhomerenderloc0fromrenderloc0groupyearcontent doesnt bleedlive sessionsbleedif ekeycode 27miid pagemoduleinstanceid0 modulecontentif swalertopen1 ifmiid findtabindexfirstfocuspagemoduleinstanceid pmi renderloc0fromrenderloc0groupyeardivswspecialmodebarif alertboxidtrimsublisthtml sublistattrariahiddentargetview containerpagemoduleinstanceid pmiif dialogoverlaywindowlargemodalbodymoderatecontentlengthheightfunction loadtaggeddatacontainer0 alertboxid okclick1 if ekeycodetrimsublisthtmlestopimmediatepropagation epreventdefault getokif dialogoverlaywindowlargemodalbodymoderatecontentlength 0if eventkeycodeuidialogoverlayclosemodalvisiblelastclick elseviewid targetview containerifepreventdefaultalertboxid oklength 0tag container 2li akeypressfunctione ifewhichifewhich 13loadgroupeddatacontainer miidrenderloc0fromrenderloc0tag tagfindtabindexfirstfocusalertboxid uiswalertattridenablequirksmode0viewid viewtouse tagepreventdefault getconference livedocumentreadyfunction varif escviewtouse ifhidmiidsidebarlistviewlength 0falseenablequirksmode0viewidcallcontrollerfailureresult0errormessagethroughelse alertboxid noclickpagemoduleinstanceid pmi renderloc0fromrenderloc0tagepreventdefault check ifoklength 0 alertboxidnoclick else ifgroupmonth groupbyflexdataid groupyeartag enablequirksmode0viewidviewtousebleed throughget idconferenceenablequirksmode0viewidviewtousethischildrenul if trimsublisthtmlswalertopen 1sublistattrariahidden trueattrariaexpandeddata successcheck ifaattrhrefviewid targetviewswalertopen uiswalertlength ifgroupby targetview tagalreadyvar renderlocsiteswchanneldropdownhidetruepagegetcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miid pagemoduleinstanceidviewtouse hidfocus etargetblur etargetclasslistremovefocusrenderlocescape keyclose dialogsitenavulheightekeycode 27etargetblur etargetclasslistremovefocusfunction e varvirtual conferencedocumentreadyfunction checkscriptmoduleviewcheckscriptmustacheuidialogoverlay uiswalert functiontaglisttaglist li akeypressfunctionebuilderundefined targetviewlength 0etargetclasslistcontainsdatepickerpmi tag viewtouserenderloc 0 variftargetview undefinedswgotosearchresultspageswsearchinput7pmi flexdataid groupyeardata success failurebuilder view targetviewundefined targetviewlengthuidialogoverlaybasemodalloadgroupeddatacontainerthischildrenul ifdialog if

Longtail Keyword Density for Imlea.org

KeywordsOccurences
27 escape key20
key estopimmediatepropagation epreventdefault20
escape key estopimmediatepropagation20
ekeycode 27 escape20
if ekeycode 2720
container 2 chksidebar12
miid pagemoduleinstanceid pmi12
getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miid pagemoduleinstanceid12
id of open10
if alertboxid oklength10
no if alertboxid10
ok or no10
ui-sw-alertattrid click ok10
alertboxid ui-sw-alertattrid click10
var alertboxid ui-sw-alertattrid10
alert var alertboxid10
open alert var10
var swalertopen ui-sw-alertlength10
e var swalertopen10
estopimmediatepropagation epreventdefault get10
1 if ekeycode10
swalertopen 1 if10
oklength 0 alertboxid10
if swalertopen 110
ui-sw-alertlength if swalertopen10
swalertopen ui-sw-alertlength if10
ui-sw-alert function e10
function e var10
epreventdefault get id10
alertboxid oklength 010
0 alertboxid okclick10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
focus etargetblur etargetclasslistremovefocus10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
epreventdefault close dialog10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
ui-dialog-overlay ui-sw-alert function10
estopimmediatepropagation epreventdefault close10
raisedbydatepicker estopimmediatepropagation epreventdefault10
alertboxid okclick else10
if raisedbydatepicker estopimmediatepropagation10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
else remove focus10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var raisedbydatepicker10
pressed on datepicker10
esc was pressed10
check if esc10
epreventdefault check if10
estopimmediatepropagation epreventdefault check10
else if ekeycode10
noclick else if10
alertboxid noclick else10
else alertboxid noclick10
okclick else alertboxid10
remove focus etargetblur10
etargetblur etargetclasslistremovefocus documentreadyfunction9
groupyear groupmonth groupmonth8
groupmonth groupmonth groupbyfield8
groupmonth groupbyfield groupby8
2 chksidebar function8
hidden sidebar list8
-sidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miid8
view var viewtouse8
miid -sidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid8
groupyear groupmonth groupby8
sidebar list view8
list view defined8
builder view var8
tag viewtouse looks8
var viewtouse ifhid-miid-sidebarlistviewlength8
ifhid-miid-sidebarlistviewlength 0 viewtouse8
0 viewtouse hid-8
hid- miid -sidebarlistviewval8
viewtouse ifhid-miid-sidebarlistviewlength 08
viewtouse hid- miid8
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
if trimsublisthtml sublistattraria-hidden5
sublistattraria-hidden trueattraria-expanded false5
pmi tag viewtouse4
tag viewid targetview4
renderloc0fromrenderloc0enablequirksmode0tag tag viewid4
viewid targetview container4
targetview container 24
chksidebar function loadtaggeddatacontainer4
function loadtaggeddatacontainer miid4
loadtaggeddatacontainer miid pmi4
miid pmi tag4
module-content- miid findtabindexfirstfocus4
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag4
pmi renderloc0fromrenderloc0tag tag4
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse4
tag enablequirksmode0viewidviewtouse container4
enablequirksmode0viewidviewtouse container 24
2 chksidebar settimeoutfunction4
chksidebar settimeoutfunction module-content-4
settimeoutfunction module-content- miid4
miid findtabindexfirstfocus 2004
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag4
groupby renderloc0fromrenderloc0enablequirksmode0tag tag4
0 targetview looks4
groupyear groupyear groupmonth4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
through the dialog4
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-4
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp4
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
documentreadyfunction tag-list li4
content doesnt bleed4
tag-list li akeypressfunctione4
li akeypressfunctione ifewhich4
akeypressfunctione ifewhich 134
ifewhich 13 thisclick4
13 thisclick function4
thisclick function loadgroupeddatacontainer4
function loadgroupeddatacontainer miid4
doesnt bleed through4
moderated content doesnt4
miid pmi groupyear4
var pageid 94
var sublist thischildrenul4
sublist thischildrenul if4
thischildrenul if trimsublisthtml4
documentreadyfunction var domainid4
var domainid 84
domainid 8 var4
8 var pageid4
pageid 9 var4
sure moderated content4
9 var renderloc4
var renderloc 04
renderloc 0 var4
0 var miid4
added to check4
check to make4
make sure moderated4
flexdataid groupyear groupyear4
loadgroupeddatacontainer miid pmi4
pmi groupyear groupmonth4
hidden detail view4
groupby targetview tag4
targetview tag iftargetview4
tag iftargetview undefined4
iftargetview undefined targetviewlength4
undefined targetviewlength 04
targetviewlength 0 targetview4
detail view defined4
flexdataid groupyear groupmonth4
builder view targetview4
view targetview hid-miid-detailviewval4
targetview hid-miid-detailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid4
hid-miid-detailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miid4
pagemoduleinstanceid pmi flexdataid4
pmi flexdataid flexdataid4
flexdataid flexdataid groupyear4
groupmonth groupby tag4
groupmonth groupby targetview4
pmi flexdataid groupyear4
viewtouse tag tag4
groupby tag viewtouse4
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear4
pmi renderloc0fromrenderloc0groupyear groupyear4
renderloc0fromrenderloc0groupyear groupyear groupmonth4
groupbyfield groupby enablequirksmode0viewid4
groupby enablequirksmode0viewid viewtouse4
miid pmi flexdataid4
enablequirksmode0viewid viewtouse tag4
tag tag container4
tag container 24
chksidebar function loaddatacontainer4
function loaddatacontainer miid4
loaddatacontainer miid pmi4
data var success3
thisremoveclasshover var sublist3
sw-channel-dropdownhide thisremoveclasshover var3
conference live sessions3
virtual conference live3
amle virtual conference3
data success failure3
var failure callcontrollerfailureresult0errormessage3
var data var3
estopimmediatepropagation epreventdefault30
if ekeycode23
key estopimmediatepropagation20
escape key20
27 escape20
ekeycode 2720
groupyear groupmonth16
else if12
container 212
2 chksidebar12
miid pmi12
getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid miid12
view defined12
miid pagemoduleinstanceid12
builder view12
pagemoduleinstanceid pmi12
function e11
if swalertopen10
alertboxid ui-sw-alertattrid10
oklength 010
alertboxid oklength10
if alertboxid10
no if10
click ok10
ui-sw-alertattrid click10
open alert10
var alertboxid10
alert var10
ui-sw-alertlength if10
get id10
alertboxid okclick10
1 if10
swalertopen ui-sw-alertlength10
swalertopen 110
0 alertboxid10
epreventdefault get10
okclick else10
close dialog10
bodyonkeydown ui-dialog-overlay-base-modal10
ui-dialog-overlay-base-modal ui-dialog-overlay10
etargetblur etargetclasslistremovefocus10
focus etargetblur10
ui-dialog-overlay ui-sw-alert10
ui-sw-alert function10
remove focus10
else remove10
ui-dialog-overlay-closemodalvisiblelastclick else10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
var swalertopen10
e var10
epreventdefault close10
var raisedbydatepicker10
alertboxid noclick10
noclick else10
epreventdefault check10
check if10
if esc10
datepicker var10
raisedbydatepicker etargetclasslistcontainsdatepicker10
etargetclasslistcontainsdatepicker if10
if raisedbydatepicker10
raisedbydatepicker estopimmediatepropagation10
else alertboxid10
etargetclasslistremovefocus documentreadyfunction9
flexdataid groupyear8
chksidebar function8
groupbyfield groupby8
groupmonth groupbyfield8
groupmonth groupmonth8
pmi flexdataid8
-sidebarlistviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid8
groupmonth groupby8
miid -sidebarlistviewval8
list view8
hid- miid8
tag viewtouse8
hidden sidebar8
sidebar list8
viewtouse looks8
view var8
var viewtouse8
viewtouse ifhid-miid-sidebarlistviewlength8
ifhid-miid-sidebarlistviewlength 08
0 viewtouse8
viewtouse hid-8
if trimsublisthtml6
var sublist6
documentreadyfunction var5
if eventkeycode5
trueattraria-expanded false5
sublistattraria-hidden trueattraria-expanded5
trimsublisthtml sublistattraria-hidden5
0 var5
pmi renderloc0fromrenderloc0tag4
renderloc0fromrenderloc0tag tag4
enablequirksmode0viewidviewtouse container4
function loadtaggeddatacontainer4
loadtaggeddatacontainer miid4
pmi tag4
tag enablequirksmode0viewidviewtouse4
0 if4
chksidebar settimeoutfunction4
settimeoutfunction module-content-4
module-content- miid4
miid findtabindexfirstfocus4
findtabindexfirstfocus 2004
viewid targetview4
function if4
activeselectorid aattrhref4
targetview container4
tag iftargetview4
tag viewid4
doesnt bleed4
13 thisclick4
ifewhich 134
akeypressfunctione ifewhich4
renderloc0fromrenderloc0enablequirksmode0tag tag4
tag-list li4
documentreadyfunction tag-list4
documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
module-content- miidfindui-widget-detailfindui-articleappendnbsp4
0 module-content-4
dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
dialog if4
bleed through4
content doesnt4
function loadgroupeddatacontainer4
moderated content4
sure moderated4
make sure4
var miid4
renderloc 04
var renderloc4
9 var4
pageid 94
var pageid4
8 var4
domainid 84
var domainid4
thischildrenul if4
sublist thischildrenul4
thisclick function4
li akeypressfunctione4
loadgroupeddatacontainer miid4
iftargetview undefined4
groupby renderloc0fromrenderloc0enablequirksmode0tag4
groupyear groupyear4
flexdataid flexdataid4
hid-miid-detailviewval getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid4
targetview hid-miid-detailviewval4
view targetview4
detail view4
hidden detail4
targetview looks4
pmi groupyear4
targetviewlength 04
undefined targetviewlength4
0 targetview4
tag tag4
renderloc0fromrenderloc0groupyear groupyear4
groupby tag4
pmi renderloc0fromrenderloc0groupyear4
targetview tag4
groupby targetview4
loaddatacontainer miid4
function loaddatacontainer4
tag container4
viewtouse tag4
enablequirksmode0viewid viewtouse4
groupby enablequirksmode0viewid4
var success3
lidata-bcsid activeselectorid3
data var3
var failure3
navs- activeselectorid3
activeselectorid aattrtarget3
pagenavigationstatecookie function3
active class3
thisremoveclasshover var3
failure callcontrollerfailureresult0errormessage3
data success3
success failure3
sw-channel-dropdownhide thisremoveclasshover3
live sessions3
amle virtual3
virtual conference3
conference live3
var data3
if119
var88
function61
047
miid40
alertboxid40
else39
epreventdefault30
estopimmediatepropagation30
viewtouse28
tag28
documentreadyfunction28
view25
groupmonth24
pmi24
ekeycode23
121
raisedbydatepicker20
key20
escape20
swalertopen20
groupyear20
check17
open16
groupby16
targetview16
set14
dialog14
activeselectorid13
e13
close13
chksidebar12
container12
flexdataid12
pagemoduleinstanceid12
hidden12
looks12
click12
defined12
builder12
getcontenthttpswwwimleaorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid8pageid9moduleinstanceid12
212
remove12
esc11
no11
li11
311
ui-dialog-overlay-closemodalvisiblelastclick10
documentonclick10
navigation10
etargetclasslistremovefocus10
etargetblur10
bodyonkeydown10
ui-dialog-overlay-base-modal10
ui-sw-alert10
focus10
ui-sw-alertlength10
ui-dialog-overlay10
oklength10
etargetclasslistcontainsdatepicker10
pressed10
noclick10
okclick10
datepicker10
false10
ok10
ui-sw-alertattrid10
alert10
id10
get10
list9
module-content-9
sidebar8
ifhid-miid-sidebarlistviewlength8
hid-8
-sidebarlistviewval8
undefined8
groupbyfield8
page8
eventkeycode7
47
active6
true6
swinnerwrapheight6
data6
trimsublisthtml6
success6
failure6
amle6
sublist6
channel6
56
href6
sublistattraria-hidden6
isedit5
userregid5
content5
trueattraria-expanded5
conference5
virtual5
sw-channel-dropdownhide5
enablequirksmode0viewid4
bleed4
doesnt4
moderated4
sure4
make4
added4
renderloc4
pageid4
64
loaddatacontainer4
dialog-overlay-windowlargemodal-bodymoderatecontentlength4
thisremoveclasshover4
thischildrenul4
sub4
class4
section4
aattrhref4
navs-4
pagenavigationstatecookie4
home4
74
documentonmouseover4
through4
domainid4
miidfindui-widget-detailfindui-articleappendnbsp4
settimeoutfunction4
renderloc0fromrenderloc0groupyear4
iftargetview4
targetviewlength4
detail4
hid-miid-detailviewval4
renderloc0fromrenderloc0enablequirksmode0tag4
viewid4
checkscriptmoduleviewcheckscriptmustache4
loadtaggeddatacontainer4
renderloc0fromrenderloc0tag4
enablequirksmode0viewidviewtouse4
documentonmouseout4
findtabindexfirstfocus4
akeypressfunctione4
tag-list4
thisclick4
loadgroupeddatacontainer4
ifewhich4
84
return3
height3
sitenavulheight3
addoffcanvasmenuheightforsitenav3
selectschoolulheight3
divsw-special-mode-bar3
eventdateid3
strcookie3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
nbsp3
ului-breadcrumbs3
aattrtarget3
lidata-bcsid3
callcontrollerfailureresult0errormessage3
swgotosearchresultspageswsearchinput3
event3
activechannelnavtype3
our3
site3
menu3
sessions3
live3
chevron3
nav3
add3
licollapsibleeachfunction3
already3
buttonproplinkhref3
parentzindex3
zindex3
openpagesubmenuthisparent3

Imlea.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Imlea.org
Indiana Middle Level Education Association / Homepage
Imleadafric.com
Imleadafric – Imagination leads
Imleader.top
imleader.top | 502: Bad gateway
Imleadgeneration.com
I'm Lead Generation
Imleading.com
502 Bad Gateway
Imleagues.com
IMLeagues
Imlearn.org
LEARN 'YOUTH SOCIAL CLUB' - Home
Imlearning.info
ControlPanel

Recently Updated Websites

Zoohandel24h.pl 4 seconds ago.Equally.in 6 seconds ago.2chefs.kitchen 7 seconds ago.Dermatologia.ru 7 seconds ago.Sdrwjx.cn 8 seconds ago.B-e.cn 10 seconds ago.Sportbedrijfamstelveen.nl 12 seconds ago.Amino.energy 12 seconds ago.Owsoa.org 13 seconds ago.Sanfordprinting.com 14 seconds ago.Evolutiontriviaquiz.com 14 seconds ago.Auntm.ai 20 seconds ago.Gulfwriter.com 20 seconds ago.Krylfrazy.ru 21 seconds ago.Williamkaiser.net 22 seconds ago.Radioamanecer.cl 23 seconds ago.Rentalcars.fo 24 seconds ago.Yahaknives.com 25 seconds ago.Recepty-po-ingredientam.ru 28 seconds ago.N-tel.in 29 seconds ago.Stavmatstavebniny.sk 29 seconds ago.Adsfo.ru 30 seconds ago.Louwarde.com 32 seconds ago.Penisibuyutme.org 33 seconds ago.Spinner.info 34 seconds ago.Sceneryscent.com 35 seconds ago.Analyse.agency 36 seconds ago.Visionsource-ausableeyecare.com 36 seconds ago.Catherinemoryc.com 39 seconds ago.Icdeurope.com 41 seconds ago.