▷ Immobilien - Häuser - Wohnungen - finden bei immowelt.de

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 14,281
Estimated Worth: $977,040

Aktuelle Immobilien, schöne Wohnungen und Häuser zur Miete oder Kauf in ganz Deutschland. Jetzt online, schnell & einfach, persönlichen Wohntraum finden!



Domain summary

Last updated
2021-04-24
Domain label
immowelt
Domain extension
de
Global Traffic Rank
14,281
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$977,040
Estimated daily income
$1,357
Estimated monthly income
$41,275

Rank summary

How is immowelt.de ranked relative to other sites:

Percentage of visits to immowelt.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Immowelt.de registered?
A: Immowelt.de was registered 3 weeks, 4 hours, 41 minutes, 44 seconds ago on Saturday, April 24, 2021.
Q: When was the WHOIS for Immowelt.de last updated?
A: The WHOIS entry was last updated 1 year, 5 months, 3 days, 4 hours, 41 minutes, 44 seconds ago on Thursday, December 12, 2019.
Q: What are Immowelt.de's nameservers?
A: DNS for Immowelt.de is provided by the following nameservers:
  • ns-1233.awsdns-26.org
  • ns-1797.awsdns-32.co.uk
  • ns-260.awsdns-32.com
  • ns-857.awsdns-43.net
Q: Who is the registrar for the Immowelt.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Immowelt.de?
A: Immowelt.de ranks 14,281 globally on Alexa. Immowelt.de has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Immowelt.de each day?
A: Immowelt.de receives approximately 113,081 visitors and 678,486 page impressions per day.
Q: What IP address does Immowelt.de resolve to?
A: Immowelt.de resolves to the IPv4 address 212.34.186.8.
Q: In what country are Immowelt.de servers located in?
A: Immowelt.de has servers located in the Germany.
Q: What webserver software does Immowelt.de use?
A: Immowelt.de is powered by webserver.
Q: Who hosts Immowelt.de?
A: Immowelt.de is hosted by ODN OnlineDienst Nordbayern GmbH in Bavaria, Nuremberg, Germany, 90449.
Q: How much is Immowelt.de worth?
A: Immowelt.de has an estimated worth of $977,040. An average daily income of approximately $1,357, which is roughly $41,275 per month.

Immowelt.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Immowelt.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Immowelt.de

H1 Headings

1 :
  1. Immobilien, Wohnungen, Häuser

H2 Headings

13 :
  1. Neu: Eigentümer-Welt
  2. Jetzt Mieter oder Käufer finden
  3. Neu: Die Eigentümer-Welt von Immowelt
  4. Das kosten Immobilien
  5. Ratgeber & Tipps
  6. Sicherheit für Mieter, Vermieter und Verkäufer Unseriöse Angebote erkennen
  7. Schnelleinstieg in deine Immobiliensuche
  8. Kaufen
  9. Mieten
  10. Bauen
  11. Sonstiges
  12. Wohnungen suchen
  13. Immobilien suchen

H3 Headings

10 :
  1. Bitte aktivieren Sie JavaScript
  2. Mieten
  3. Kaufen
  4. Bauen
  5. Weiteres
  6. Interhyp Baufinanzierung
  7. Umbauen und Renovieren
  8. Umlageschlüssel, Fristen und Co.: Wie Vermieter Nebenkosten abrechnen
  9. Mieterselbstauskunft: Wann Mieter lügen dürfen
  10. Den perfekten Bauplatz finden: Tipps zum Grundstückskauf

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

78:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Immowelt.de

imanzeigewohnung mietenhierdiemietenzimmer abvermieterauf immoweltdezimmer3friwnavlinklistmeta ulwohnungimmoweltdudeinist2kaufen hausbism178vonfindestkaufenabartikelmietermieten wohnungfunctioninserierenulrenditeobjekte1findenm178 abfindest duleseniwagdeineaufsonstigeswohnungengewerbeimmobilienartikel lesennulleuroaktionjetzt0hauspaddingregistrationsieimmoweltdeapplicationserverkeyvarderiwnavlinklistmetabernehmen20pxzumdenwiesuchenimmobilien

Who hosts Immowelt.de?

Immowelt.de Hosting Provider Information

Hosted IP Address:212.34.186.8
Hosted Hostname:212.34.186.8
Service Provider:ODN OnlineDienst Nordbayern GmbH
Hosted Country:GermanyDE
Location Latitude:49.4177
Location Longitude:11.0297
Webserver Software:Not Applicable

Is "ODN OnlineDienst Nordbayern GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
ODN OnlineDienst Nordbayern GmbH
0.0004%

HTTP Header Analysis for Immowelt.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Cache-Control: no-cache, no-store
Pragma: no-cache
Expires: -1
Server:
Server-Timing: intid;desc=29c780690a868e74
X-Content-Type-Options: nosniff
X-Xss-Protection: 1;mode=block
X-Frame-Options: SAMEORIGIN
X-POWERED-BY:
Date: Sat, 24 Apr 2021 23:52:22 GMT
Content-Encoding: gzip
X-Cache: Miss from cloudfront
Via: 1.1 5e9462d78e1fd171400e24a377935ad0.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR62-C2
X-Amz-Cf-Id: PVj9eJHcraw2IIDmv43NQ1AQzs6hMrXhmgqb3o0d8E1F_1lJ-FWRyg==

Immowelt.de Domain Nameserver Information

HostIP AddressCountry
ns-1233.awsdns-26.org 205.251.196.209
ns-1797.awsdns-32.co.uk 205.251.199.5
ns-260.awsdns-32.com 205.251.193.4
ns-857.awsdns-43.net 205.251.195.89


Need to find out who hosts Immowelt.de?


Domain Registration (WhoIs) information for Immowelt.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: immowelt.de
Nserver: ns-1233.awsdns-26.org
Nserver: ns-1797.awsdns-32.co.uk
Nserver: ns-260.awsdns-32.com
Nserver: ns-857.awsdns-43.net
Status: connect
Changed: 2019-12-12T04:59:23+01:00

Websites with Similar Names

Immowaechter.com
502 Bad Gateway
Immowalter.com
IMMOWALTER | immowalter
Immowatch.de
Home - Ihr IT-Systemanbieter in Borken - com.kom IT-Systemlösungen GmbH
Immoways-france.com
Error 404 (Not Found)!!1
Immoweb.app
immoweb.app
Immoweb.be
Immoweb: Belgium's leading property website
Immoweb.brussels
Combell.com Parkpage
Immoweb.ca
Bienvenue chez ImmoWeb

Recently Updated Websites

Protectmenowtexas.com (1 second ago.)Supplychainguru.us (2 seconds ago.)My-answermall.shop (2 seconds ago.)Boxzone.nl (3 seconds ago.)Persohood.com (4 seconds ago.)Savejoeexotic.com (4 seconds ago.)Nightwise-sleep.com (4 seconds ago.)Heritageoftibet.com (4 seconds ago.)Actisportsarena.com (5 seconds ago.)Signshopilluminated.com (5 seconds ago.)Xinjiangzao.cn (5 seconds ago.)Paraguay.org (6 seconds ago.)Chezpierre.nl (6 seconds ago.)Mobilyumavm.com (7 seconds ago.)Networkanalyticsltd.com (7 seconds ago.)Florencemagazine.com (8 seconds ago.)Schrockroof.com (8 seconds ago.)Coviran.tienda (9 seconds ago.)Maanyamaanya.xyz (9 seconds ago.)Trueflagarmy.com (9 seconds ago.)Shengruikejiao.com (9 seconds ago.)Campbellrivergardenclub.com (10 seconds ago.)Cricketbrownmusic.com (11 seconds ago.)Ciglipakhaliyikama.com (11 seconds ago.)Nrirealtors.com (11 seconds ago.)Levoyageenfrance.info (11 seconds ago.)Cloudcomrade.info (12 seconds ago.)Cargoclaims-llc.com (12 seconds ago.)Senyuxuan.xyz (12 seconds ago.)Autoinsu.space (12 seconds ago.)

Recently Searched Keywords

sponsored editorial (3 seconds ago.)wloadedplatformdependencies if typeof (12 seconds ago.)citeşte întregul articol (13 seconds ago.)ago 12 (19 seconds ago.)038 over 1 (20 seconds ago.)culard charolais (24 seconds ago.)v h (25 seconds ago.)lien than tuong (27 seconds ago.)txt_trang_chu (29 seconds ago.)khng c rng (31 seconds ago.)招标 意思 (32 seconds ago.)tv show (33 seconds ago.)christine bannon-rodrigues (34 seconds ago.)sandeepmarwah (36 seconds ago.)khn gi (36 seconds ago.)thantuong (38 seconds ago.)margin-top 10pxnnotifyemptydisplay none (38 seconds ago.)itemstablet (40 seconds ago.)than tuong.lienquan (42 seconds ago.)itemsmobile (44 seconds ago.)0 1 1px (45 seconds ago.)feribot seferleri yalova pendik (47 seconds ago.)asus dual geforce rtx 2070 mini – тест видеокарты в данном видео мы тестируем и… (47 seconds ago.)¿listo para lo que viene (53 seconds ago.)rakuten viki (57 seconds ago.)dynamic gas (1 minute 6 seconds ago.)カーライフ、バイク[3,182件] (1 minute 13 seconds ago.)recommended category for you - latina (1 minute 14 seconds ago.)con luz (1 minute 20 seconds ago.)storm type-b (1 minute 20 seconds ago.)